DOSEN PROFIL LENGKAP

within genetic material (DNA or RNA sequences of nucleotide triplets or codons) into proteins. Translation is accomplished by the ribosome, which links...

In molecular biology, a stop codon (or termination codon) is a codon (nucleotide triplet within messenger RNA) that signals the termination of the translation...

A codon table can be used to translate a genetic code into a sequence of amino acids. The standard genetic code is traditionally represented as an RNA...

The Codon Adaptation Index (CAI) is the most widespread technique for analyzing codon usage bias. As opposed to other measures of codon usage bias, such...

The start codon is the first codon of a messenger RNA (mRNA) transcript translated by a ribosome. The start codon always codes for methionine in eukaryotes...

Degeneracy or redundancy of codons is the redundancy of the genetic code, exhibited as the multiplicity of three-base pair codon combinations that specify...

A codon is a three-base sequence of DNA that encodes a single amino acid in the genetic code Codon may also refer to: Codon (plant), a genus of plants...

point mutation in a sequence of DNA that results in a nonsense codon, or a premature stop codon in the transcribed mRNA, and leads to a truncated, incomplete...

Cahn-Ingold-Prelog sequence rules. Codons can also be expressed by: CGN, AGR. Codons can also be expressed by: CUN, UUR. Codons can also be expressed by: CTN...

Codon usage bias refers to differences in the frequency of occurrence of synonymous codons in coding DNA. A codon is a series of three nucleotides (a...

corresponding to the mRNA codon, in the case of the start codon, this is the amino acid methionine. The next codon (adjacent to the start codon) is then bound by...

frames are defined as spans of DNA sequence between the start and stop codons. Usually, this is considered within a studied region of a prokaryotic DNA...

nature of gene expression by codons, the insertion or deletion can change the reading frame (the grouping of the codons), resulting in a completely different...

binding of complementary transfer RNA (tRNA) anticodon sequences to mRNA codons. The tRNAs carry specific amino acids that are chained together into a polypeptide...

tRNA specifies which three-nucleotide codon from the genetic code corresponds to which amino acid. Each mRNA codon is recognized by a particular type of...

protein. A ribosome links amino acids together in the order specified by the codons of mRNA molecules to form polypeptide chains. A ribosome is made up of a...

Codon is a genus of planthoppers in the family Fulgoridae, subfamily Stronglyodematinae. Species occur in South Africa. Codon adrastus Fennah, 1967 Codon...

amino acids are coded for by more than one three-base-pair codon; since some of the codons for a given amino acid differ by just one base pair from others...

Codon royenii is a species of flowering plant in the genus Codon. It is native to Namibia and the Northern Cape Province of South Africa. It is also known...

genetic code, there are 43 = 64 possible codons (three-nucleotide sequences). For translation, each of these codons requires a tRNA molecule with an anticodon...

nearby UGA codon as selenocysteine (UGA is normally a stop codon). In some methanogenic prokaryotes, the UAG codon (normally a stop codon) can also be...

was first isolated in 1921 by John Howard Mueller. It is encoded by the codon AUG. It was named by Satoru Odake in 1925, as an abbreviation of its structural...

sequences as codons, groups of three nucleotides. Each codon represents a single amino acid in a protein chain. However, there are more codons (64) than...

are arranged into codons consisting of three ribonucleotides each. Each codon codes for a specific amino acid, except the stop codons, which terminate...

Codon schenckii is a species of flowering plant in the genus Codon. It is native to Namibia and the Northern Cape Province of South Africa. It is also...

encoded by the stop codons—TGA and TAG respectively.) The mismatch between the number of codons and amino acids allows several codons to code for a single...

Codon is a small genus of plants from South Africa in the family Codonaceae in the order Boraginales. It is the only genus in the family, and comprises...

both carry a mutation at codon 178 of the prion protein gene. FFI is also invariably linked to the presence of the methionine codon at position 129 of the...

Effective number of codons (abbreviated as ENC or Nc) is a measure to study the state of codon usage biases in genes and genomes. The way that ENC is computed...

permit short (< 600bp) open reading frames (ORFs) due to frequent stop codons. The short ORFs could have contained the short protein-coding exons observed...

is an artificially modified genetic code in which one or more specific codons have been re-allocated to encode an amino acid that is not among the 22...

compositionally driven, synonymous codon-usage bias affects the nucleotide topology. As substitutions between serine codon families can proceed through threonine...

Typically codons, sets of three mRNA nucleotides, correspond to one specific amino acid. Codon reassignment is the exception to this rule. When a codon is reassigned...

ERF1 gene. In Eukaryotes, eRF1 is an essential protein involved in stop codon recognition in translation, termination of translation, and nonsense mediated...

is the initiation codon encoding a methionine amino acid at the N-terminus of the protein. (Rarely, GUG is used as an initiation codon, but methionine is...

expression by eliminating mRNA transcripts that contain premature stop codons. Translation of these aberrant mRNAs could, in some cases, lead to deleterious...

termination codon (a stop was lost), resulting in abnormal extension of a protein's carboxyl terminus. Start-gain creates an AUG start codon upstream of...

the rare codon can affect the timing of translation, and in turn the co-translational folding of the protein. This is reflected in the codon usage bias...

2,501,097 bp. Micrococcus luteus was one of the early examples of novel codon usage, which led to the conclusion that the genetic code is not static,...

Since 1970 it has been organising different activities for its members. CODON is the study Association for all Biotechnology (BBT and MBT), Bioinformatics...

Allozyme Alternative splicing Altruism Alu family Alzheimer's disease Amber codon Ames test Amino acid Amino acid sequence Amino acids Amniocentesis Amorph...

messenger RNA. It is generally located around 8 bases upstream of the start codon AUG. The RNA sequence helps recruit the ribosome to the messenger RNA (mRNA)...

5'UTR to locate a start codon to commence elongation. Sometimes, the scanning ribosome bypasses the initial AUG start codon and begins translation at...

mutagenesis technique used in protein engineering, in which a single codon or set of codons is substituted with all possible amino acids at the position. There...

non-overlapping 3-mers are called codons. While each codon only maps to one amino acid, each amino acid can be represented by multiple codons. Thus, the same amino...

of a messenger RNA (mRNA) that is directly upstream from the initiation codon. This region is important for the regulation of translation of a transcript...

respect to codon usage, the ambush hypothesis theorizes that there is a positive correlation between the use of a codon and the amount a codon contributes...

The Koudounia (Greek: κουδούνια), are bell-like percussion instruments. Most often, they are made from copper and upon playing (that is, hitting them with...

which can bind with a termination codon on mRNA; b) a mutation on ribosomes decreasing the effect of a termination codon. It is believed that nonsense suppressors...

27 and 31, is remarkable in that every one of the 64 possible codons can be a sense codon. Experimental evidence suggests that translation termination...

phages. The Rho-dependent terminator occurs downstream of translational stop codons and consists of an unstructured, cytosine-rich sequence on the mRNA known...

for the termination of translation by recognizing the termination codon or stop codon in an mRNA sequence. They are named so because they release new peptides...

in a stop codon after 21 codons 0.0 Male C to A substitution in intron V, at 3' splicing acceptor site before exon VI Premature stop codon - Male Insertion...

translation initiated at the usual AUG or a similar (CUG, GUG, UUG, or ACG) start codon. This results in expression of a pathogenic protein encoded by one particular...

28 and 31, is remarkable in that every one of the 64 possible codons can be a sense codon. Translation termination probably relies on context, specifically...

definitive evidence in favor of universal common descent. The way that codons (DNA triplets) are mapped to amino acids seems to be strongly optimised...

The encoding of proteins is done in groups of three, known as codons. The standard codon table applies for humans and mammals, but some other lifeforms...

codes were discovered in bacterial genomes by Shulgina and Eddy using their codon assignment software Codetta, and validated by analysis of tRNA anticodons...

numbered codon 50 from ATG to AGG, or deletion of that codon, has been reported in a variety of solid tumors. With the protein size correction, this codon is...

UGA represents an additional glycine codon and does not code for termination. A survey of many genomes with the codon assignment software Codetta, analyzed...

variations in alternative start codons. A Possible start codons in NCBI table 1. AUG is most common. The two other start codons listed by table 1 (GUG and...

familial insomnia is thought to be the result of a point mutation in PRNP at codon 178, which corroborates PrP's involvement in sleep-wake cycles. In addition...

Globe de Paris G2G Racing, an American stock car racing team GTG, a codon in the DNA codon table for the amino acid valine G2G, government-to-government, as...

possible codons in the genetic code are stop codons, one would expect a stop codon approximately every 20–25 codons, or 60–75 base pairs, in a random sequence...

27 and 28, is remarkable in that every one of the 64 possible codons can be a sense codon.    AAs = FFLLSSSSYYEECCWWLLLLPPPPHHQQRRRRIIIMTTTTNNKKSSRRVVVVAAAADDEEGGGG...

methods in a user interface Codon redundancy, the redundancy of the genetic code exhibited as the multiplicity of three-codon combinations Cytokine redundancy...

series of triplets (codons) of four possible nucleotides can be translated into one of twenty possible amino acids. A sequence of codons results in a corresponding...

vertebrata. AGA and AGG were thought to have become mitochondrial stop codons early in vertebrate evolution. However, at least in humans it has now been...

stabilize the formation of ribosomal preinitiation complexes around the start codon and are an important input for post-transcription gene regulation. Several...

the tRNA which is linked to the growing polypeptide chain. When a stop codon is reached, the peptidyl-tRNA bond of the tRNA located in the P-site is...

Typed Set Theory; see New Foundations Phenylalanine, an amino acid with the codon TTT Tilt table test, a medical test for dysautonomia and/or syncope The...

occurs in all transfer RNAs (tRNAs) that read codons starting with C except in those tRNAs that read CAN codons. m1G can help prevent errors in protein synthesis...

with slight variations, notably the use of UGA as a tryptophan codon rather than a stop codon.    AAs = FFLLSSSSYY**CCWWLLLLPPPPHHQQRRRRIIIMTTTTNNKKSSRRVVVVAAAADDEEGGGG...

variable codons, is a technique in computational phylogenetics that allows the hypothesized rate of molecular evolution at individual codons in a set...

of Health (NIH). The experiment deciphered the first of the 64 triplet codons in the genetic code by using nucleic acid homopolymers to translate specific...

phenylalanine transfer RNA that stabilizes interactions between the codons and anti-codons during protein synthesis. Ensuring accurate synthesis of protein...

(Trp, W), Tyrosine (Tyr, Y), Valine (Val, V) This code uses the initiation codons AUG, GUG and UUG. Pachysolen tannophilus List of genetic codes This article...

series of three base pair codons which code for individual amino acids; this "triplet-code" is summarized in DNA and RNA codon tables. The experiment also...

Pyrrolysine (symbol Pyl or O), encoded by the "amber" stop codon UAG, is a proteinogenic amino acid that is used in some methanogenic archaea and in bacteria...

DNA or RNA into protein; any continuous stretch of codons that contains a start codon and a stop codon. operator A regulatory sequence within an operon...

nucleic acid (CeNA). The incorporation of XNA in a plasmid, involving 3 HNA codons, has been accomplished already in 2003. This XNA is used in vivo (E coli)...

that base pairs with specific nucleotide triplets on the mRNA called codons; codons encode a specific amino acid. This interaction is possible thanks to...

by mRNA binding, and starts codon-P-site interaction. IF2 enters with the initiator tRNA and places it on the start codon. GTP hydrolysis by IF2 releases...

same time as, or shortly after, another drug Concomitantly variable codon, a codon in a computational phylogenetic model in which the hypothesized rate...

amino acids making up a protein strand. Each group of three bases, called a codon, corresponds to a single amino acid, and there is a specific genetic code...

redundancy of the 3 codons that encode a "stop" signal. If one of these can be substituted by another stop codon, then that codon can in principle be...

to higher G+C content. This has been pointed to the fact that the stop codon has a bias towards A and T nucleotides, and, thus, the shorter the sequence...

translation. Each group of three nucleotides in the sequence, called a codon, corresponds either to one of the twenty possible amino acids in a protein...

of alternative codons in pterobranchs and comparison with the standard genetic code Genetic code Translation table DNA codon RNA codon Translation with...

a codon substitution model (a codon is three bases and codes for one amino acid in a protein). There are 4 3 = 64 {\displaystyle 4^{3}=64} codons, resulting...

required for catalytic activity. The selenocysteine is encoded by the UGA codon that normally signals translation termination. The 3' UTR of selenocysteine-containing...

conserved bases around the initiation codon from all human mRNAs (Kozak consensus sequence). Note that the initiation codon is not drawn to scale, otherwise...

particular genetic makeup; those who were methionine-homozygous at the PRNP codon 129 methionine/valine polymorphism. Studies of similar diseases in other...

N-terminus toward its C-terminus. For example, in a typical gene a start codon (5′-ATG-3′) is a DNA sequence within the sense strand. Transcription begins...

premature stop codons (an effect referred to as "read-through") by promoting insertion of certain near-cognate tRNA at the site of nonsense codons with no apparent...

polypeptide chain when the ribosome encounters a stop codon. While eRF1 recognizes stop codons, eRF3 facilitates the release of the polypeptide chain...

The ciliate macronuclear code has not been determined completely. The codon UAA is known to code for Gln only in the Oxytrichidae.    AAs =...

CodonCode Aligner is a commercial application for DNA sequence assembly, sequence alignment, and editing on Mac OS X and Windows. Features include chromatogram...

in a codon of RNA, cytosine is synonymous with uracil, as they are interchangeable as the third base. When found as the second base in a codon, the third...

P102L mutation, which causes a substitution of proline to a leucine in codon 102, has been found in the prion protein gene (PRNP, on chromosome 20) of...

the IMA symbol for the pyroxene mineral Augite AUG, the most common start codon, often encoding the amino acid methionine Augusta Railroad, defunct Arkansas...

After Health Care Vote – CBS News". CBS News. Retrieved October 29, 2023. Codon, Stephanie (March 22, 2010). ""Fire Nancy Pelosi" Becomes GOP Slogan After...

Variation in translation of the mitochondrial genetic code occurs when DNA codons result in non-standard amino acids has been identified in invertebrates...

into some proteins at a UGA codon, which is normally a stop codon. Pyrrolysine is incorporated into some proteins at a UAG codon. For instance, in some methanogens...

would be enough to define all 20 amino acids. This concept is the basis of "codons", and set an upper and lower limit on their size. Gamow had simply estimated...

Missense mRNA is a messenger RNA bearing one or more mutated codons that yield polypeptides with an amino acid sequence different from the wild-type or...

nature of gene expression by codons, the insertion or deletion can disrupt the reading frame, or the grouping of the codons, resulting in a completely different...

example when reaching the end of a messenger RNA which has lost its stop codon. The tmRNA is remarkably versatile: it recycles the stalled ribosome, adds...

mRNA sequence contains codons: 3 nucleotide long segments that code for a specific amino acid. Ribosomes translate the codons to their respective amino...

suppressor mutations for tRNA. The Garen lab also showed that certain triplet codons (5'-UAG, 5'-UAA, and 5'-UGA) failed to bind amino acids. Thus, the Garen...

nucleotide substitution are particularly high in the third position of a codon, where there is little functional constraint. This view is based in part...

AUU may refer to: an abbreviation for Adelaide University Union AUU, a codon for the amino acid isoleucine Aurukun Airport, IATA airport code "AUU" This...

terminators. In the context of translation, a termination signal is the stop codon on the mRNA that elicits the release of the growing peptide from the ribosome...

each of 26 codons, these being chosen out of the total of 64. These DNA codons would then be transcribed into the complementary RNA codons, which would...

addition of a TAG stop codon in the middle of gIII. Synthetases that aminoacylate the TAG codon's suppressor tRNA prevents stop codon activity, allowing for...

Paramecium, only UGA is decoded as a stop codon, while UAG and UAA are reassigned as sense codons (that is, codons that code for standard amino acids), coding...

termination of translation in response to the peptide chain termination codons. Initially thought to have a role in the termination of mitochondria protein...

comprehensive approach is site saturation mutagenesis where one codon or a set of codons may be substituted with all possible amino acids at the specific...

Kozak, M (1987). "At least six nucleotides preceding the AUG initiator codon enhance translation in mammalian cells". J Mol Biol. 196 (4): 947–50. doi:10...

E, Mueller S (June 2008). "Virus attenuation by genome-scale changes in codon pair bias". Science. 320 (5884): 1784–87. Bibcode:2008Sci...320.1784C. doi:10...

messenger RNA (mRNA) transcript, and can therefore be used to read the expected codon sequence that will ultimately be used during translation (protein synthesis)...

specific tRNA molecules could recognize multiple codons. The area of the tRNA that recognizes the codon called the anticodon is able to bind multiple interchangeable...

virus to have a noticeable codon usage bias. For instance, arginine's six different codons have a relative synonymous codon usage of AGA (2.67), CGU (1...

notable differences" For example, Codon uses 64-bit machine integers for speed, not arbitrarily as with Python; Codon developers claim that speedups over...

an enzyme Galactoside acetyltransferase, an enzyme Aspartic acid (codon: GAT), an amino acid Khat (or gat), a stimulant plant Gat air pistol, a...

code. Instead, it is encoded in a special way by a UGA codon, which is normally the "opal" stop codon. Such a mechanism is called translational recoding and...

of interest at its two ends. Only one codon of a three codon amino acid sequence is substituted. The type of codon set, will determine the number of sequences...

circumstances, making it a nonessential amino acid. It is encoded by the codons UCU, UCC, UCA, UCG, AGU and AGC. This compound is one of the proteinogenic...

sequencing whole mitochondrial genomes. ATA, GTG and TTG ATT is the start codon for the CytB gene in Halocynthia roretzi. List of genetic codes This article...

experiment). This greatly sped up the assignment of three-base codons to amino acids so that 50 codons were identified in this way. Khorana's experiments confirmed...

which lack part of the TAD and DBD. Alternative translation initiation at codons 40 or 160 results in ∆40p53 and ∆160p53 isoforms, respectively. p53 regulates...

Sharp, Paul M.; Li, Wen-Hsiung (1987). "The codon adaptation index-a measure of directional synonymous codon usage bias, and its potential applications"...

RECODE is a database of "programmed" frameshifts, bypassing and codon redefinition used for gene expression. Translational frameshift Baranov, P V; Gurvich...

start codon within the large A genes. Only genes A* and K are thought to be non-essential, although there is some doubt about A* because its start codon could...

messenger RNA (mRNA) that immediately follows the translation termination codon. The 3′ UTR often contains regulatory regions that post-transcriptionally...

identified to have a 4 base pair deletion. This induces a premature stop codon in the receptor that is absent in all straight haired cats analyzed. LPAR6...

Additionally, a "start codon", and three "stop codons" indicate the beginning and end of the protein coding region. There are 64 possible codons (four possible...

mutation is a point mutation in which a single nucleotide change results in a codon that codes for a different amino acid. It is a type of nonsynonymous substitution...

serotonin, the hormone melatonin, and vitamin B3 (niacin). It is encoded by the codon UGG. Like other amino acids, tryptophan is a zwitterion at physiological...

mouse model was described in 1990 and carries an Apc allele with a stop codon at position 850. Heterozygosity for this mutation results in a fully penetrant...

binding site (RBS), is a sequence of nucleotides upstream of the start codon of an mRNA transcript that is responsible for the recruitment of a ribosome...

deletion in the 126th codon in exon 5 of the SOD1 gene. This mutation produced a frameshift mutation, which led to a stop codon at position 131. SOD1...

albicans and C. tropicalis, but not, for instance, C. glabrata) the CUG codon, which normally specifies leucine, specifies serine in these species. This...

alternative mitochondrial codes. Further, the AUA, AUC, and AUU codons are all allowable start codons. Some of these differences should be regarded as pseudo-changes...

primarily targeted on the control of ribosome recruitment on the initiation codon, but can also involve modulation of peptide elongation, termination of protein...

Transport's ICAO code CTT, a specialty certification of Comp TIA CTT, a codon for the amino acid Leucine × Cattlianthe (Ctt.), a nothogenus of orchids...

non-essential in humans, meaning the body can synthesize it. It is encoded by the codons AAU and AAC. The one-letter symbol N for asparagine was assigned arbitrarily...

syndrome differs as it was more specifically linked to a mutation on the R702 codon on the MYH9 gene. Diseases with mutations on the MYH9 gene also include...

could be as many as n3 codons. Research is currently being done to see if codons can be expanded to more than 3 bases. These new codons can code for new amino...

protein that functions as a releasing factor that recognizes termination codons and releases mitochondrial ribosomes from the synthesized protein (summary...

it is caused by a nonsense mutation in codon 1027 of the COL4A5 gene on the X chromosome (glycine to stop codon), which is similar to Alport's syndrome...

South Carolina, US Campaign for Good Governance, in Sierra Leone CGG, a codon for the amino acid arginine CGG repeats, a trinucleotide repeat disorder;...

and its carboxyl group deprotonated (as −CO−2). Alanine is encoded by all codons starting with GC (GCU, GCC, GCA, and GCG). The L-isomer of alanine (left-handed)...

discharge date Stop-loss variant, a genetic variant that causes loss of a stop codon Stop-Loss (film), a 2008 film about soldiers subject to the stop-loss policy...

the ribosome's A site for the UGA codon to be decoded. In bacteria, the SECIS element occurs soon after the UGA codon it activates. The situation with...

phylogenetic analysis in 2008, and all members possess a unique single codon deletion in the phosducin (PDC) gene. The phyllodactylid genus Bogertia...

genetic code between species possessing this alternative code is that the codon CUG (normally encoding the amino acid leucine) is translated by the yeast...

shortened to TAG Tumor-associated glycoprotein, a type of protein TAG, a stop codon Tag (game), a playground game Tag (horse), an 18th-century thoroughbred...

of Medicine, in 1997. Some sORF are so small, usually shorter than 100 codons, that they were believed to have no protein-coding genes to make functional...

the AAGGag motif located about 6 nt (median distance) upstream of start codons as the consensus Shine–Dalgarno sequence in H. pylori. The proteome of H...

create start and stop codons, but it cannot destroy existing start and stop codons. A cryptic start codon is created when the codon ACG is edited to be...

acids do not have a dedicated codon, but are added in place of a stop codon when a specific sequence is present, UGA codon and SECIS element for selenocysteine...

in the Royal Canadian Navy Leucine, represented in genetic codon code; see DNA and RNA codon tables You the Rock, Japanese hip-hop musician also known...

Nobel Prize in Physiology or Medicine (1968) for the elucidation of how codons are utilized for protein synthesis Antonia Novello – first woman and first...

scanning and selection of the start codons. This can create changes in the selection of the factors, binding to different codons. Another important eukaryotic...

Hayashi-Ishimaru; T Ohama; Y Kawatsu; K Nakamura; S Osawa (June 1996). "UAG is a sense codon in several chlorophycean mitochondria". Current Genetics. 30 (1): 29–33...

stop codons (leading to early termination of protein synthesis and truncated proteins). Aminoglycosides can cause the cell to overcome the stop codons, insert...

hard to characterize morphologically if it includes the genera Codon and Wellstedia. Codon was long regarded as an unusual member of Hydrophyllaceae, but...

amino acid Glutathione hydrolase, an enzyme that hydrolyzes glutathione A codon for the amino acid Glycine Germline gene therapy, to treat genetic diseases...

as codons, from one end of the mRNA to the other (from the 5' to the 3' end) starting with the amino acid methionine as the start (initiation) codon AUG...

displayed in a thicker way on a graphical representation (e.g.: the start codon of a gene) No 8 thickEnd End coordinates from which the annotation is no...

1580 (nt) in the DNA sequence (CGT codon) causing the guanine to be replaced with the thymine, yielding CTT codon in the DNA sequence, results at the...

amino acid, it is more hydrophilic than phenylalanine. It is encoded by the codons UAC and UAU in messenger RNA. The one-letter symbol Y was assigned to tyrosine...

f9c186b5-5bdf-42f6-b105-b8071c370c67 Open Tree of Life: 670513 PLANTS: CODON POWO: urn:lsid:ipni.org:names:5656-1 Tropicos: 40011401 WFO: wfo-4000008798...

site represents the third position in a stop codon. When the adenosine is absent, a downstream stop codon is used, and the encoded protein extends for...

equate to amino acids or stop signals during translation, they are called codons. A single strand of a nucleic acid molecule has a phosphoryl end, called...

circuits related to limb movement and motion, causes a "premature 'stop codon'" in horses with lateral ambling gaits. Such breeds include the following:...

readthrough site facilitates the mechanism of translation readthrough of the stop codon at the gag-pol junction producing the gag and pol fusion protein in certain...

Holley and Marshall Warren Nirenberg after DNA was understood to contain codons. The Human Genome Project was launched in 1990 to map the human genome....

S2CID 25912333. He W, Zhang H, Zhang Y, Wang R, Lu S, Ji Y, et al. (October 2017). "Codon usage bias in the N gene of rabies virus". Infection, Genetics and Evolution...

example, the ribosome has to select the correct tRNA that matches the mRNA codon among many structurally similar tRNAs. If the recognizer and its correct...

because the genetic code itself is degenerate, meaning several different codons can code for the same amino acid. This allows different organisms to have...

spanning codons for amino acid positions 507 and 508 of the CFTR gene on chromosome 7, which ultimately results in the loss of a single codon for the amino...

nt NP_001287948.1 264 aa Alternate exons 1 and 2, uses alternate start codon 7 isoform d NM_001301021.2 3166 nt NP_001287950.1 263 aa Alternate exons...

(December 2018). Parkinson's Disease: Pathogenesis and Clinical Aspects. Codon Publications. ISBN 978-0-9944-3816-4. Greenland JC, Barker RA, Greenland...

known single stranded RNA virus (~70%). Despite this high GC content its codon use is similar to that of its human host. The viruses attach to the cell...

"Consensus" is defined as protein-coding regions that agree at the start codon, stop codon, and splice junctions, and for which the prediction meets quality...

Arg, Thr, Ser; conservation is observed in these 5 codons whereas mutating the upstream codons do not alter the operon expression. If the ribosome attempts...

products, soy products, and beans and other legumes. It is encoded by the codons UUA, UUG, CUU, CUC, CUA, and CUG. Leucine is named after the Greek word...

Graphics Core Next, an AMD graphics microarchitecture series Degenerate codon for the amino acid Alanine (A) Grand Canyon National Park Airport (IATA...

Anti-codon recognition leaves the "wobble" base free to accommodate certain non-Watson/Crick basepairs, thus providing an atomic description of both codon:anti-codon...

maturation/lysis protein A2; the coat protein; a readthrough of a leaky stop codon in the coat protein, called A1; and the β-subunit of an RNA-dependent RNA-polymerase...

literature. For instance, mutation biases are frequently invoked in models of codon usage. Such models also include effects of selection, following the...

mineral Carbonic anhydrase inhibitor, in pharmacology Codon Adaptation Index, a measure of codon bias in protein-coding DNA sequences Cold air intake,...

number of possible codons is 64; hence, there is some redundancy in the genetic code, with some amino acids specified by more than one codon. Genes encoded...

1967. His medical dissertation at Yale was titled, "Differences in RNA codon recognition as a function of cellular tRNA content". Beaudet completed a...

nucleotides) directs the cell to translate UGA codons as selenocysteines (UGA is normally a stop codon). SECIS elements are thus a fundamental aspect...

found between codons 1460 and 1575. The 3C protease domains span codons 2183 to 2327. The usual eight RdRp domains are located between codons 2493 and 2828...

Assertive community treatment, a system for treating mental illness ACT, a codon for the amino acid Threonine ACT (audio format), a file format Act or S-act...

This structural motif was previously thought to cause the UAG (amber) stop codon to be translated to the amino acid pyrrolysine instead of ending the protein...

In addition, it was found that an amber mutation produces a "nonsense codon" within a gene that causes polypeptide chain termination during translation...

mammals; the human and murine sequences are identical. However, the start codon of human FNDC5 is mutated to ATA.[citation needed] This causes human FNDC5...

histidine: guanine (G)-> adenosine (A) transition in the second codon position of the 74th codon in the protein) mutation in the PRKAR1A gene, confirming a...

similar to the low GC-content of the base composition translational stop codons like TAG, TAA, and TGA. GC-rich areas are also where the ratio point mutation...

switch from arginine (389R) to glycine (389G) at the 389 codon position. Arginine at codon 389 is highly preserved across species and this mutation happens...

complex in search of the translation initiation start codon. Accurate identification of the start codon is very important, as other translation start sites...

identified an association between susceptibility to sCJD and a polymorphism at codon 129 in the PRNP gene, which encodes the prion protein (PrP). A homozygous...

molecule in a polymer Aspartylglucosaminuria, a rare genetic illness a codon for the amino acid serine All Grown Up!, an animated television series Attorney...

Conceptual translation of TMED5. Labeled are the start and stop codon, exon splice sites, domains and motifs, polyadenylation signals, predicted RNA and...

libraries (formed by de novo gene synthesis where alternative nucleotides or codons are incorporated). DNA library technology is a mainstay of current molecular...

American strains around 1892. Scans for natural selection showed that most codons of the SLE virus ORF were evolving neutrally or under negative selection...

Aspartate transaminase, or aspartate aminotransferase, an enzyme AAT, a codon for the amino acid asparagine Achanalt railway station Ath, Belgium (Dutch:...

sequence. It is caused by a nonsynonymous missense mutation which changes the codon sequence to code for a different amino acid than the original sequence....

increases, and glutamine must be obtained from the diet. It is encoded by the codons CAA and CAG. It is named after glutamic acid, which in turn is named after...

Lee, Ronald W. Smith, Gerald Solomon, Michael Moore, Chris McBee, Caryl Codon-Tharp, Faith Vecchio, Rebecca De Morrio, Joan Phillips Improbable Cause...

in exon 1 of the human MBL2 gene, at codon 52 (Arg to Cys, allele D), codon 54 (Gly to Asp, allele B) and codon 57 (Gly to Glu, allele C), also independently...

eukaryotes. The 3' UTR is found immediately following the translation stop codon. The 3' UTR plays a critical role in translation termination as well as...

64 codons is circular with an asymmetric distribution of codons that leads to a clear segregation between GC-rich 4-codon boxes and AU-rich 2:2-codon and...

arthropod hosts. Dietary nitrogen availability has been shown to alter codon bias and genome evolution in Mycoplasma and the plant parasites Phytoplasma...

stem that meet in a cloverleaf pattern. The anticodon that recognizes a codon during the translation process is located on one of the unpaired loops in...

or "shunt over", parts of the 5' untranslated region to reach the start codon. However, a benefit of ribosomal shunting is that it can translate backwards...

single mRNA transcript larger than 16 kb. ApoB48 is generated when a stop codon (UAA) at residue 2153 is created by RNA editing. There appears to be a trans-acting...

transient component of the ectoderm Effective number of codons, a measure to study the state of codon usage biases in genes (-NC) Isocyanide, an organic functional...

established in Kampala in 2008 Cursor Up (ANSI), an ANSI X3.64 escape sequence a codon for the amino acid leucine This disambiguation page lists articles associated...

gene variants is caused by a single nucleotide polymorphism in the start codon of the gene which can be distinguished through the use of the Fok1 enzyme...

pathway Tyrosine aminotransferase, an enzyme encoded by the TAT gene TAT, a codon for the amino acid Tyrosine Talbot railway station, Australia Tattenham...

stop codon. Another type of mutation that deals with stop codons is known as a nonstop mutation or readthrough mutation, which occurs when a stop codon is...

codons (phase 0 introns), between the first and second nucleotide of a codon (phase 1 introns), or between the second and third nucleotide of a codon...

is considered to be more stable in eukaryotic cells due to being human codon optimized and utilizing three minimal transcriptional activation domains...

allele in the Agouti gene in dogs (R96C arginine to cysteine mutation at codon 96). This recessive black gene is also thought to have derived from wild...

approximately half these patients harbor point mutations of the BRAF gene at codon 600 substituting the amino acid glutamine for valine. A diagnosis from neurological...

humans, meaning the body can synthesize it as needed. It is encoded by the codons GAU and GAC. In proteins aspartate sidechains are often hydrogen bonded...

these pause sites were tested with specific codons. No link was found between the occupancy of specific codons and amount of their tRNAs. Thus, the early...

"Computational Analysis of a Prebiotic Amino Acid Synthesis with Reference to Extant Codon–Amino Acid Relationships". Life. 11 (12): 1343. Bibcode:2021Life...11.1343Y...

(Sec) residue at its active site. The selenocysteine is encoded by the UGA codon, which normally signals translation termination. The 3' UTR of Sec-containing...

singer-songwriter Ochre River, Manitoba, in Canada Ochre, a type of genetics stop codon Ocher, alternative spelling of Ochyor, a town in Perm Krai, Russia Ogre...

His doctoral thesis, submitted in 1992, was titled Studies of Synonymous Codon Evolution in Mammals and supervised by William G. Hill. Eyre-Walker joined...

translation but can also bind to uracil and adenosine, though it is not favored. Codon changes may arise from RNA editing leading to changes in the coding sequences...

produce a single protein due to ribosomal readthrough of a leaky UAG stop codon. The four genes encode a replicase (with methyltransferase [MT] and RNA...

mRNA, but the stop codon is interpreted as an amino acid-encoding codon. In consequence, translation continues to the next stop codon. This leads to the...

three-letter 'words' called codons formed from a sequence of three nucleotides (e.g., ACT, CAG, TTT). In transcription, the codons of a gene are copied into...

has been used for over 60 years, and notably, the first elucidation of a codon was done by Marshall Nirenberg and Heinrich J. Matthaei in 1961 at the National...

Germany Gau (Final Fantasy VI), a character in Final Fantasy VI GAU, a codon for the amino acid aspartic acid Gouais blanc, a French wine grape Enfariné...

dipeptides and tripeptides thus revealing that UAG, UAA, and UGA are stop codons. Their Nobel lecture was delivered on 12 December 1968. Khorana was the...

terminator is located 69 bases downstream from the translational termination codon. The carboxy terminal portion of the protein exhibits extensive homology...

initiation codons are those of lacI (GUG) and lacA (UUG) in the E. coli lac operon. Two studies have independently shown that 17 or more non-AUG start codons may...

runtime environments for a number of other languages, including Crystal, the Codon high performance python compiler, the GNU Compiler for Java runtime environment...

longer-term studies to be essential for adults also. It is encoded by the codons CAU and CAC. Histidine was first isolated by Albrecht Kossel and Sven Gustaf...

with its putative binding interaction to the target mRNA sodB. The start codon for sodB is underlined. RyhB nucleotides that participate in the interaction...

airport code for Camilo Daza International Airport, Cúcuta, Colombia CUC, codon for the amino acid leucine This disambiguation page lists articles associated...

Office of the Inspector General (Brazil), abbreviated CGU in Portuguese a codon for the amino acid arginine a cash generating unit, an IFRS accounting term...

from the non-essential amino acid L-glutamate. It is encoded by all the codons starting with CC (CCU, CCC, CCA, and CCG). Proline is the only proteinogenic...

mutations that prematurely terminate the synthesized protein (early stop codon). The term pharmacogenomics is often used interchangeably with pharmacogenetics...

other RNA helicases such as Ded1/DDX3 and DHX29) to locate the start codon. Start codon recognition occurs through base-pairing between the Met-tRNAiMet and...

(although with thymine replaced by uracil). It is this strand which contains codons, while the non-coding strand contains anticodons. During transcription,...

for premature stop codons. The assembly of this complex is triggered by premature translation termination. If a premature stop codon is detected then the...

identification, the most commonly identified disablements are premature stop codons and frameshifts, which almost universally prevent the translation of a functional...

to reflect mutational tendencies. Mutational biases also contribute to codon usage bias. Although such hypotheses are often associated with neutrality...

fictional military contractor in the Doom video game franchise UAC, a codon for the amino acid tyrosine This disambiguation page lists articles associated...

display, end clipping, and consensus determination; other programs like CodonCode Aligner also implement quality-based consensus methods. Quality scores...

mitochondrial genes, nuclear genes display several informative sites in third codon positions that evolve rapidly enough to accumulate synapomorphies, but slow...

gene in congenital hyponychia and evidence for a polymorphic initiation codon (p.M1I). BMC Med Genet 13(1):120 Wiktionary has definitions related to Anonychia...

"Synthesis of guanosine tetra- and pentaphosphate requires the presence of a codon-specific, uncharged transfer ribonucleic acid in the acceptor site of ribosomes"...

The Sequence Independent Method for Simultaneous Site-Saturation of Five Codons". PLOS ONE. 6 (10) e26222. Public Library of Science (PLoS). Bibcode:2011PLoSO...

the codons match or not by examining whether the codon and anticodon are bound will not be able to tell the difference between wrong and right codon with...

study it was shown that genes are expressed as non-overlapping triplets (codons). Researchers showed that mutations caused by either a single base insertion...

bacteria Global Technology Associates, an Internet firewall maker GTA, a codon for the amino acid valine GTA Teleguam, a telecommunications company in...

revealed a higher proportion of valine homozygous (VV) genotype on the codon 129 of the gene encoding the prion protein (PRNP) compared with the general...

Genetic Code Variants Including the Reassignment of All Three Stop Codons to Sense Codons in Condylostoma magnum". Molecular Biology and Evolution. 33 (11):...

acids, depending on the genotype, and is the result of the second start codon in the open reading frame. Once a threshold of HBcAg proteins are translated...

with conversion to preferred mammalian codons, the removal of reported cryptic splice sites, an altered stop codon, and reduced CpG content to reduce the...

translates UGA to glycine, and CGG and GCA to tryptophan, as determined by the codon assignment software Codetta; it was further shown that these recodings are...

ribosome to overcome the stop codon and produce a full-length CFTR protein. About 10% of CF results from a premature stop codon in the DNA, leading to early...

commonly used in citrus here. Schmidt et al., 2006 find point mutations at codon 200 conferring TBZ resistance are common in California. Karnal Bunt (Tilletia...

Retrieved 2026-05-06. Seitz, Kiley W.; et al. (2021). "Recoding of stop codons expands the metabolic potential of two novel Asgardarchaeota lineages"....

TMEM145 conceptual translation. This includes the signal peptide, cleavage site, exon boundaries, transmembrane domains, and the start and stop codons....

and deletion generates conserved amino acid sequences and AUG initiation codons". Cell. 53 (3): 401–411. doi:10.1016/0092-8674(88)90160-2. ISSN 0092-8674...

Crick. (Of course, 'unlike with unlike' increases the number of possible codons, if this scheme were a genetic code.) Goldstein, Bernard R. (1977) Ibn Mu'adh's...

patients with chronic urticaria". Allergologia et Immunopathologia. 44 (4). Codon Publications: 286–291. doi:10.1016/j.aller.2015.10.004. ISSN 0301-0546....

The ingenuous 1964 Nirenberg and Leder experiment would identify the mRNA codons, a triplet sequence of ribonucleotides, that coded for each amino acid;...

proposed cause of neurocutaneous melanosis is a mutation of the NRAS gene at codon 61. This mutation has been detected in patients with congenital melanocytic...

or symbol: Angor language (ISO 639-3 code) Arginine, an amino acid with codon AGG Tirofiban, trade name Aggrastat, an antiplatelet drug People: Alfred...

Polycythemia Congenital cyanosis (HbM Boston) arises from a mutation in the α-codon which results in a change of primary sequence, H → Y. Tyrosine stabilizes...

zwitterion structure −OOC−CH(NH+ 3)−(CH 2)2−COOH. It is encoded by the codons GAA or GAG. The acid can lose one proton from its second carboxyl group...

bacterial species sequenced by 2009. These elements carry core genes and have codon usage similar to the chromosome, yet use a plasmid-type replication mechanism...

No No Console-based (no GUI), yet with colors. Coding DNA is coloured by codon. FASTA, PHYLIP, Nexus, Clustal, Stockholm Free, GPL 3 No Cross-platform...

bioinformatics platforms. It is fully integrated into software programs such as CodonCode Aligner, DNASTAR's Lasergene, Geneious, and MacVector, and is also available...

possible codons, while an expanded DNA alphabet with 9 DNA bases would have 93 = 729 possible codons, many of them synthetic codons. For these codons to be...

pronounced effect than a transition because the second and third nucleotide codon position of the DNA, which to a large extent is responsible for the degeneracy...

Tanja; Hugenholtz, Philip; Rinke, Christian (2021-12-01). "Recoding of stop codons expands the metabolic potential of two novel Asgardarchaeota lineages"....

cellular mechanism to prevent translation of mRNA molecules lacking a stop codon Non-stop flight, an airplane flight with no intermediate stops This disambiguation...

cork taint in wine Tricyclic antidepressant, a class of medications TCA, a codon for the amino acid serine Taiwanese Cultural Association Tekeyan Armenian...

Gua (disambiguation), the name of two different communes in France GUA, a codon for the amino acid valine Gua or Guanine, a nucleobase found in the nucleic...

fungi, animals, protists and plants. While most of the 3-base sequences (codons) in the mtDNA of these organisms do code for the same amino acids as those...

'haplotype'. This haplotype, Super-B8, is A1-Cw7-B8-DR3-DQ2, about 2 million DNA codons (the nucleotide building blocks) long. This chunk has avoided recombination...

viral DNA. E1 is the largest open reading frame (ORF), which is the set of codons in the genome that code for proteins, encoding a 602 amino acid protein...

an eight-nucleotide scar sequence, which codes for a tyrosine and a stop codon, is left between every segment added into the plasmid. Golden Gate assembly...

Holmes Dobson, Virginia Grobeson, Leslie Ann Anderson, Laura Connolly, Caryl Codon-Tharp, Carol Pershing CBS Babylon 5 "The Geometry of Shadows" Tracy Smith...

Zhifeng; Wedenoja, Juho; et al. (2010). "A population-specific HTR2B stop codon predisposes to severe impulsivity". Nature. 468 (7327): 1061–6. Bibcode:2010Natur...

and the biological pigment melanin. It is encoded by the messenger RNA codons UUU and UUC. The one-letter symbol F was assigned to phenylalanine for its...

Poison exons (PEs); also called premature termination codon (PTC) exons or nonsense-mediated decay (NMD) exons] are a class of cassette exons that contain...

amino acids encoded by each codon are shown. Annotations in the figure include: an upstream in-frame stop, start and stop codons, exon boundaries, amino acids...

Duon may refer to the following things: A DNA codon also serving as part of a transcription factor binding site Moel y Cerrig Duon, a summit in north...

dairy products, soy products, beans and legumes. It is encoded by all codons starting with GU (GUU, GUC, GUA, and GUG). Valine was first isolated from...

ability, increasing expression and stimulating neutralizing antibodies; a codon-optimized gene of the full-length spike protein of SARS-CoV-2 (bases 103–3879);...

Nucleobase Adenine Cytosine Guanine Thymine Uracil Adenovirus Antibody Bacteria Codon Deoxyribonucleic acid (DNA) Messenger RNA mRNA Enzyme Exon Intron nucleotide...

SARS-CoV (about 155 codons) and SARS-CoV-2 (only 22 codons). Exacerbating the confusion, both the 57-codon protein product and the 22-codon protein product...

water at physiological pH), aliphatic amino acid. It is encoded by the codons AAA and AAG. Like almost all other amino acids, the α-carbon is chiral and...

resulting proteins. Bok mRNA comprises five exons and two alternative start codons for translation (AUG). Exons are visualized as arrows and boxes in different...

with this syndrome have an identical genetic change, an inframe single codon deletion in POLD1 resulting in a loss of serine at position 605. The POLD1...

"Direct evidence of autosomal recessive inheritance of Arg24 to termination codon in purine nucleoside phosphorylase gene in a family with a severe combined...

correctable through the replacement of slippery sequences with synonymous codons. The frameshifting is not known to contribute to any safety issues with...

Diagram depicting gelsolin and the amyloid protein derived from it because of mutations in codon...

Analytical ultracentrifugation, Physical and biophysical chemistry instrument a codon for the amino acid isoleucine Aalborg University, formerly Aalborg University...

group A allele, a guanosine base is subsequently deleted. A premature stop codon results from this frame-shift mutation. This variant is found worldwide...

was composed of sequences of three DNA base pairs known as triplets or codons which represent one of the twenty amino acids. Genetic coding helped researchers...

University, a state health sciences university in Uttarakhand, India A codon for the amino acid tyrosine UAU: A subunit of South Korean girl group, Dreamcatcher...

Challenge, a competition among completely-automatic hacking systems CGC, a codon for the amino acid arginine Chen Guangcheng, also known as the "Blind Lawyer"...

Rothuizen, J.; van Oost, B (2000). "Identification of a premature stop codon in the melanocyte-stimulating hormone receptor gene (MC1R) in Labrador and...

cloning vector – closed circulatory system – cobalamin – codominance – codon – coenzyme – cofactor – collagen – collecting duct – commensalism – competitive...

residues. Selenocysteine is coded by a UGA codon, which generally signifies termination of a peptide through a stop codon. In point mutation experiments with...

forum which provides free help and support on all consumer issues CAG, a codon that encodes the α-amino acid glutamine CAG, ISO provincial code for the...

the result of Jones' regular use of a metaphor of nucleotides as letters, codons as words and genes as sentences, but also reflecting Jones' short explanation...

the 3' end. Codon use is not random; codons ending in adenosine are favoured, and those ending in cytosine or guanine are avoided. Codon use differs between...

"Investigating the Inhibitory Effect of Wortmannin in the Hotspot Mutation at Codon 1047 of PIK3CA Kinase Domain: A Molecular Docking and Molecular Dynamics...

due to alteration in the 3rd coding causing redundancy. For example, the codon CUA is mutated into CUG; which still codes for leucine, therefore not making...

are more evenly distributed. The 5 exons of the APRT gene are indicated (blue), and the start (ATG) and stop (TGA) codons are emphasized (bold blue)....

Change Function Description rs1456067444 554 1 [T/G] [M/R] missense start codon rs749501877 679 46 [A/G] [N/S] missense N-glycosylation site rs776889950...

GALC gene that causes a frameshift mutation leading to a premature stop codon. The GALC gene, found on chromosome 14 at position 31 (14q31), codes for...

translation) causes ribosomes to have a higher rate of read-through of stop codons, an effect that results in suppression of nonsense mutations in other genes...

mutations were identified, cluster I at codons 507-533, cluster II at codons 563-572, and cluster III at codon 687. The majority of these mutations are...

Valine (Val, V). The remaining CGN codons are rare in Saccharomyces cerevisiae and absent in Candida glabrata. The AUA codon is common in the gene var1 coding...

comprehensive approach is site saturation mutagenesis where one codon or a set of codons may be substituted with all possible amino acids at the specific...

base, rather than a triplet, to encode each amino acid, and suggested 18 codons, correctly predicting one for proline. Other work established the mechanistic...

Colberg, J; Caro, JF (Jun 1995). "Evidence against either a premature stop codon or the absence of obese gene mRNA in human obesity". The Journal of Clinical...

Isoleucine J Leucine (L) or Isoleucine (I) K Lysine L Leucine M Methionine/Start codon N Asparagine O Pyrrolysine (rare) P Proline Q Glutamine R Arginine S Serine...

the anti-Shine-Dalgarno sequence, which binds upstream to the AUG start codon on the mRNA. The 3′-end of 16S RNA binds to the proteins S1 and S21 which...

loss of function of that site. Results in exposure of a premature stop codon, loss of an exon, or inclusion of an intron. Mutation of a splice site reducing...

amino acid matching the anticodon of the tRNA, and in turn matching the codon of the mRNA, is used during protein synthesis. In order to prevent translational...

", by David Guetta from Listen Stop (dog), a part of a dog's skull Stop codon, a type of RNA molecule in genetic code STOP protein, a protein in animals...

structure might be incomplete. The RNAs are located nearby to the start codons of genes predicted to encode a PBP transporter. The RNAs might therefore...

are found in the 6 TEDC2 isoforms. Green = contains a start codon. Red = contains a stop codon. Check = Exon included in the final mRNA transcript. -- =...

"Viral Proteins Originated De Novo by Overprinting Can Be Identified by Codon Usage: Application to the "Gene Nursery" of Deltaretroviruses". PLOS Computational...

Translation CRACDL Part 1. The upstream stop codon is orange, the exon boundaries are highlighted blue, the start codon is green, the predicted nuclear location...

changes by e.g. truncation of C-terminus after introducing premature stop codon. Site-directed mutagenesis Phi value analysis missense mutation nonsense...

is 10,362 base pairs long. It starts translation at a different start codon than variant 1 by utilizing an alternate splice site. The 5’ region is relatively...

2 protein, mutations in codons specifying 67 different residues have been identified, with multiple mutations in the codons of several amino acids. The...

Tyr316Ter mutation in the coding region of FUT1. The mutation introduces a stop codon, leading to a truncated enzyme that lacks 50 amino acids at the C-terminal...

entire coding sequence lies within the bounds (between the start codon and the stop codon) of a larger external gene. The coding sequence for a nested gene...

The Gulf Clan), a drug cartel and paramilitary group in Colombia AGC, a codon for the amino acid serine Agra Cantonment railway station in Uttar Pradesh...

viral genome is being as economic as possible by only needing a few protein codons to make a large structure. One of the major functions of a capsid is to...

recognition of the corresponding mRNAs' codons. In the absence of queuosine modification, translation at Q-decoded codons slows down to the point that many...

exons, a coding sequence of 1881 nucleotides, and an upstream in-frame stop codon. The coding sequence is the 36-660 bases of the gene TMEM212. Other genes...

sequencing was performed. A point mutation that changes a triplet codon to a premature stop codon. Allada et al concluded that the Jrk mutation disrupts the...

attenuated familial adenomatous polyposis with a new germline APC mutation at codon 161: report of a case". Diseases of the Colon and Rectum. 45 (10): 1397–402...

is coded for by gene C (HBcAg), and its start codon is preceded by an upstream in-frame AUG start codon from which the pre-core protein is produced. HBeAg...

composition (uuu) -- triple up quarks UUU, or uracil uracil uracil, the RNA codon for phenylalanine Uranium One (TSX: UUU, JSE: UUU), Canadian-based uranium...

between G→A results in an amino acid change from valine to methionine at codon 158. The A or Met allele is associated with lower enzymatic activity (due...

therapeutic research and drug screenings. HCT116 cells have a mutation in codon 13 of the KRAS proto-oncogene, and are suitable transfection targets for...

from the symmetrical distribution of the codons. This symmetry allows for arythmic exploration of the codon distribution. In 2013, shCherbak and Makukov...

Mariani-Costantini, R (ed.). Paraganglioma: A Multidisciplinary Approach. Codon Publications. ISBN 978-0-9944381-7-1. PMID 31294944. Retrieved 16 March...

acid similarities based on how many base changes were required to change a codon to code for that amino acid. This model is better, but it doesn't take into...

shift mutation at the glycosyltransferase domain (c.1457insG) located at codon 486 of exon 6 of the EXT1 gene, that causes multiple osteochondromas. This...

proposed by Williamson. Interspecific hybrids Hybrids in nature Hybrid plants Codon usage bias Heterosis Gene flow Introgression Francis Maitland Balfour "Donald...

resulting structure interacts with the codon CAA at codon 2153 and deaminates it into UAA, producing a stop codon that results in mRNA that is translated...

performed several tasks related to annotation, such as base and codon counts. In fact, codon usage was the main strategy used by several early protein coding...

(homozygotes). CCR5 Δ32 is a 32-base-pair deletion that introduces a premature stop codon into the CCR5 receptor locus, resulting in a nonfunctional receptor. CCR5...

in exon 1 at position 66. Editing results in a codon change from a glutamine codon to an arginine codon. T/A site This site is also found in exon 1, at...

(2011). "Precise Manipulation of Chromosomes in vivo Enables Genome-wide Codon Replacement". Science. 333 (6040): 348–53. Bibcode:2011Sci...333..348I....

in symbionts and parasites, which commonly experience rapid evolution, codon reassignments, biases for AT nucleotide compositions, and elevated levels...

2019, Start Codon, a UK based life sciences accelerator system announced its partnership with Calira. Calira would provide Start Codon's clients with...

factor Tachyarrhythmia absoluta, a form of cardiac arrhythmia TAA, a stop codon in molecular biology Thoracic aortic aneurysm Tanganyika African Association...

mammals. In most species, stop codon is TAA, and TGA in Mus musculus. Deletions, insertions and mutations of stop codons affect the coding part and its...

long on average. The stabilising ones start at the stop codon, and without them the stop codon (UAA) is not complete as the genome only encodes the U or...

promoting the inclusion of a pseudoexon that harbors a premature termination codon, leading to degradation of HTT mRNA and a consequent decrease in HTT protein...

glycosylase; see Deamination Autoimmune autonomic ganglionopathy AAG, a codon for the amino acid lysine American Association of Geographers Association...

optimizing protein over-expression. Contact Primary citation Wu & al. (2007) Release date 2006 Access Website http://www.umbc.edu/codon/sgdb/index.php...

isolates suggested that this virus has evolved into three clades differing in codon usage, host, and geographic distribution. In early 2022, a new MERS-related...

There are 35 different known mutations of WRN, which correspond to stop codons, insertions, or deletions that result in a frameshift mutation. These mutations...

Archived from the original on April 19, 2015. Retrieved April 22, 2015. Codon, Patrick (April 20, 2015). "Senate votes to bar state money for soccer stadium"...

endosperm-specific promoter is used. The codons of the gene must be optimized for the organism due to codon usage bias. Transgenic plants have genes inserted...

1962 (southern Africa) Capocles Emeljanov, 2004 Capenopsis Melichar, 1912 Codon Fennah, 1962 Strongylodemas Stål, 1853 Tecmar Fennah, 1962 Xosopharinae...

food additive, cysteine has the E number E920. Cysteine is encoded by the codons UGU and UGC. Like other amino acids (not as a residue of a protein), cysteine...

one serotype of the virus has been found, but multiple genotypes exist. Codon use within the genome is biased and unusually distinct from its host. It...

which can saturate up to five independent codons on a gene. This method removes redundant codons and stop codons. This is a PCR based method. Cassette mutagenesis...

ammeter cccDNA (covalently closed circular DNA), a special form of DNA CCC, a codon for the amino acid proline Chaos Computer Club, hacker organisation Citizen...

Holmes Dobson, Virginia Grobeson, Leslie Ann Anderson, Laura Connolly, Caryl Codon-Tharp, Carol Pershing CBS Babylon 5 "The Geometry of Shadows" Tracy Smith...

GC-rich codons (Gly, Ala, Arg, Pro), and likewise, adaptive walks under AT bias result in proteins with more of the amino acids with AT-rich codons (Phe...

reduced evolution rates. Sperm genes have short coding sequences, high codon bias, and disproportionate representation among orphan genes. These characteristics...

initiation codon of the EBNA-LP coding region is created by an alternate splice of the nuclear protein transcript. In the absence of this initiation codon,...

half-life and, in turn, protein production. Replacing rare codons with synonymous codons frequently used by the host cell also enhances protein production...

RG, Kerr IB, Mehta AR, et al. (April 1991). "High frequency mutation in codons 12 and 61 of H-ras oncogene in chewing tobacco-related human oral carcinoma...

hormone-like protein. Variations in structure, receptor specificity, and codon sequence occur even between different strains of the same species. However...

start codon of the second reading frame is suppressed by the lack of a strong Shine-Dalgarno sequence and a stable hairpin structure. The start codon of...

the alternative genetic code of its mitochondria which use TTA as a stop codon instead of coding for Leucine. This code is represented by NCBI translation...

in codon-usage bias resulting in differential levels of gene expression by altering the rate of transcription in mutants with non-preferred codons. Hence...

bind to its own messenger RNA (mRNA) immediately upstream of the AUG start codon, to inhibit its translation by competing with ribosome binding, and thus...

Protein signal which causes the release of transcribed RNA at a stop codon...

classification, a climate classification system Triclocarban, a disinfectant TCC, a codon for the amino acid serine Take Command Console, a command line interpreter...

cytosine-guanine-guanine (CGG) codons in the virus' RNA, more precisely in the crucial furin cleavage site. The CGG codon is one of several codons that translates into...

lung tissue. The most common isoform, FMO2*2A, contains a premature stop codon, leading to a truncated protein with no catalytic activity that is probably...

cryptic splice site in the human ALG3 gene generates a premature termination codon insensitive to nonsense-mediated mRNA decay in a new case of congenital...

Analysis of mRNA Methylation Reveals Enrichment in 3′ UTRs and near Stop Codons". Cell. 149 (7): 1635–1646. doi:10.1016/j.cell.2012.05.003. PMC 3383396...

PMID 37454340. Yoshizaki Y, et al. (December 2024). "CHAMP1 premature termination codon mutations found in individuals with intellectual disability cause a homologous...

Hemichordata, except that it uses UAA for tyrosine rather than as a stop codon. This code shares with many other mitochondrial codes the reassignment of...

by Motorola for their early mobile phones (Total Area Coverage) TAC, a codon for the amino acid Tyrosine TAC, a mixture of tetracaine, adrenaline and...

Clinical Significance Rs963273525 Amino Acid 1 TC MetVal Missense In start codon (CDS) N/A Rs1800736098 Base pair 8 CA N/A Transversion mutation Conserved...

in later stages of the translation initiation mechanism. After the start codon has been engaged by the scanning initiation complex, eukaryotic initiation...

residues in mRNA can affect the coding specificity of stop codons UAA, UGA, and UAG. In these stop codons, both a U→Ψ modification and a U→C mutation promote...

sequences. Since the genetic code is degenerate, some mutations result in codons that code for the same amino acid. Such synonymous substitutions are far...

along with accessory genes bel1 (tas) and bel2 (bet). No in-frame stop codons are present in the coding regions. Virions share the general spumaviral...

start the Biobricks Foundation. He was also a co-founder of the now-defunct Codon Devices, a biotechnology startup company that aimed to commercialize synthetic...

travels to the planet Aranhaschimmia to investigate a disturbance in the Codon Stream, discovering that the planet has become infested with DNAliens. On...

telemetry, and control, a subsystem of spacecraft and ground segments TTC, a codon for the amino acid phenylalanine Cugir Tokarov, a Romanian variant of the...

translation, attaches to the carboxyl end of the growing chain. Since the start codon of the genetic code codes for the amino acid methionine, most protein sequences...

structurally different to perform the same function or yield the same output Codon degeneracy, in genetics Degeneration (medicine) Degenerative disease, a...

three-base codons. If the location of the open reading frame (ORF) is known, rates of mutation can be adjusted for position of a given site within a codon, since...

twenty-one PE2 variants with different Cas9 mutations, reverse transcriptase codon usages, nuclear localization sequences (NLS), protein linker lengths, and...

naturally. Arg residues are common components of proteins. It is encoded by the codons CGU, CGC, CGA, CGG, AGA, and AGG. The guanidine group in arginine is the...

subunit (30S), which then assembles other translation machinery. The start codon, typically found 8 nucleotides downstream of the Shine-Dalgarno sequence...

Fieldata, in IBM "BCD" format, and in Braille. Enough to uniquely identify one codon of genetic code. The size of code points in Base64; thus, often the entropy...

SK, Lanigan SW, Bowden PE (2000). "Two different mutations in the same codon of a type II hair keratin (hHb6) in patients with monilethrix". J. Invest...

XIII) with alternatively spliced transcripts and translation termination codon at the 5' end of the last exon". Proc. Natl. Acad. Sci. U.S.A. 85 (20):...

Amino Acids in Deep-Level Arthropod Phylogenomics: Differentiating Serine Codons in 21-Amino-Acid Models". PLOS ONE. 7 (11) e47450. Bibcode:2012PLoSO...747450Z...

nucleotides is not divisible by three, i.e., the number of nucleotides per codon. Frameshift mutations will alter all the amino acids encoded by the gene...

during the process of translational recoding of the UGA stop codon. In addition to the UGA-codon, a cis-acting element in the mRNA, called SECIS, binds SBP2...

Gear) Electronic. Castor Cracking Group, a demo (computer art) group CCG, a codon for the amino acid proline Center for China and Globalization, a think tank...

language (ISO 639-3 code: ggg), a Rajasthani language of Pakistan GGG, a codon for the amino acid glycine 3G (disambiguation) G3 (disambiguation) This...

mutation in nucleotide 1431 which converts a Tryptophan (TGG) into a stop codon (TGA), resulting in a shorter and inactive tyrosinase gene. Other albinos...

protein that is defective. The other mutation involves the deletion of a codon, three nucleotides that code for a lysine (Lys). In the wrinkled frog (Glandirana...

gene. There are 105 Human Reference SNPs that result in premature stop codons in 103 genes. This corresponds to 0.5% of coding SNPs. They occur due to...

(1 December 2019). "Conservation and Variability of the AUG Initiation Codon Context in Eukaryotes". Trends in Biochemical Sciences. 44 (12): 1009–1021...

D.S. (July 2019). "Adult-onset Leigh syndrome linked to the novel stop codon mutation m.6579G>A in MT-CO1". Mitochondrion. 47: 294–297. doi:10.1016/j...

factor hUpf1 and may be recruited to mRNAs containing premature termination codons. This protein also participates in the TGF-beta signaling pathway. DCP1A...

common hotspots in several human cancers, which are on codons 175, 248 and 273. The other two codons are 280 and 285 do not have CpG sites. These sites are...

acids. A protein is created by ribosomes that "read" RNA that is encoded by codons in the gene and assemble the requisite amino acid combination from the genetic...

Individual Achievement in Hairstyling for a Series Josée Normand, Caryl Codon, Rebecca De Morrio, Dino Ganziano, Virginia Kearns, Audrey Levy, Shawn McKay...

lacking in the cytoplasmic form due to use of an alternate translation start codon. This protein is upregulated by interferon-alpha but does not contain the...

of the sequence. Not only that, but it has two sequences coding for stop codons, as can be seen in the image. Most miRNA seem to congregate around the two...

David D. (June 2002). "An improved DNA‐based test for detection of the codon 616 mutation in the alpha cyclic GMP phosphodiesterase gene that causes...

transfusion TTA – Racing Elite League, a Swedish touring car championship TTA, a codon for the amino acid Leucine This disambiguation page lists articles associated...

code, where each triplet (called a codon) specifies a particular amino acid. They also obtained evidence that the codons do not overlap with each other in...

transcriptase was observed. However the majority of ERS are defective (stop codons in all reading frames) and contain large deletions of a putative retroviral...

Conceptual Translation of KLHL36 Transcript Variant 1 mRNA, including BTB/POZ domain, BACK domain, Kelch Motifs, start and stop codons, and exon boundaries....

1099/00221287-131-4-951. PMID 2985742. Rowland GC, Lim PP, Glass RE (July 1992). "'Stop-codon-specific' restriction endonucleases: their use in mapping and gene manipulation"...

duplication and fusion to form a large tandem repeat. Next, start and stop codons are introduced at corresponding locations in the duplicated gene, removing...

synthesized from aspartate in bacteria such as E. coli. It is encoded by all the codons starting AC (ACU, ACC, ACA, and ACG). Threonine sidechains are often hydrogen...

Composite Likelihood Model Syn-Nonsynonymous - Sequences are compared codon-by-codon, only available for protein coding sequences. Nei-Gojobori Method Modified...

and Behaviour. McInerney's early research career focused on the study of codon usage in a variety of organisms including Trichomonas vaginalis and Borrelia...

Surveillance Mechanism That Eliminates Transcripts Lacking Termination Codons". Science. 295 (5563): 2258–61. Bibcode:2002Sci...295.2258F. doi:10.1126/science...

the team had shown that a gene in M. barkeri had an in-frame amber (UAG) codon that did not signal the end of a protein, as would normally be expected...

code, where each triplet (called a codon) specifies a particular amino acid. They also obtained evidence that the codons do not overlap with each other in...

autism and a polymorphic GGC/CGG repeat preceding the 5' ATG initiator codon of the RELN gene in an Italian population. Longer triplet repeats in the...

subset of what they called "cryptic introns" that did not contain stop codons and are now deemed exitrons. The same researchers conducted further studies...

aids in the initiation of mRNA translation and recognizing the AUG start codon. However, once eIF2α is phosphorylated, the complex’s activity reduces,...

DNA codons RNA codons This code (22) Standard code (1) TCA UCA STOP = Ter (*) Ser (S) TAG UAG Leu (L) STOP = Ter (*)...

for the genetic coding of its mitochondria which translate TCA as a stop codon and TAG as leucine. This code is represented by NCBI translation table 22...

hypermutation in immunity and cancer: Critical analysis of strand-biased and codon-context mutation signatures". DNA Repair. 45 (2016): 1–2 4. doi:10.1016/j...

of Archean age Transmit/receive transition gap in communications TTG, a codon for the amino acid Leucine TTG Studios, Los Angeles, US Travel Trade Gazette...

chromosomes, labeled A-G. This species uses an alternative genetic code for the codon CUG, coding for the amino acid serine instead of the usual leucine. The...

The first anticodon position pairs with the third "wobble" position in codons, and queuosine improves accuracy of translation compared to guanosine. Synthesis...

likelihood M.N. Price, P.S. Dehal, A.P. Arkin fitmodel Fits branch-site codon models without the need of prior knowledge of clades undergoing positive...

encodes it. The protein is found in rodents, but not in humans, because stop codons in the gene's coding sequence prevent the gene from expressing a functional...

deaminase acts on RNA, bringing post transcriptional modification by altering codons and different protein functions. Guide RNAs are small nucleolar RNAs that...

specific regions of the transcriptome; it is mostly found close to stop codons, in 3’-UTRs and in long internal exons. Nevertheless, m6A levels vary between...

diamino acid (i.e. a component of proteins), and is accordingly coded by codons of the genetic material. In the pH range found inside living cells, both...

Africa Madeleine Gug (1913–1971), French film editor Valine, encoded by codon GUG Gugs, creatures in H. P. Lovecraft's novella The Dream-Quest of Unknown...

the start codon region of Bcl-2 mRNA. In vitro studies led to the identification of oblimersen, which is complementary to the first 6 codons of Bcl-2 mRNA...

isoforms have been identified for this gene. By using alternative initiation codons in the same reading frame, two isoforms (alpha and beta) are encoded by...

and the high-coverage Denisovan sequence contain the same premature stop codons as modern humans and hence dating should be greater than 750 000 years ago...

conjecture, a mathematical conjecture proved in 2014 by Thomas Royen GCC, a codon for the amino acid alanine Gibbon Conservation Center, in Santa Clarita...

sickle cell disease. HbS is produced by a point mutation in HBB in which the codon GAG is replaced by GTG. This results in the replacement of hydrophilic amino...

edema, smooth muscle spasm and nociceptor stimulation. Alternate start codons result in two isoforms of the protein. Bradykinin receptor GRCh38: Ensembl...

Escherichia coli, by reducing the natural number of 64 codons in the bacterial genome to 59 codons instead, in order to encode 20 amino acids. In 2020,...

mutations at guanine in codon 249 of the p53 gene, a tumor suppressing gene, and at several guanine residues in the 12th and 13th codons of the ras gene, a...

protein S17) is thought to be involved in the recognition of termination codons. This gene is co-transcribed with a small nucleolar RNA gene, which is located...

truncated proteins can result from the introduction of a premature stop codon can result from nonsense, splice-site, or frame shift sequence changes,...

Ultimatrix, which is synced to the Prototype Omnitrix's DNA source, the Codon Stream. Ben has wielded the Ultimatrix for over a year since defeating Vilgax...

very slow; the ribosome can even be stalled when it encounters a rare codon, a codon found at low concentrations in the cell. The slow synthesis rate and...

messenger RNA interactions. Typically, if an incorrect tRNA pairs with an mRNA codon at the aminoacyl site of the ribosome, adenosines 1492 and 1493 are excluded...

likelihood phylogenetic tree based on 13 protein-coding genes partitioned by codon, and nodes with less than 70% bootstrap support are collapsed, forming polytomies...

code, where each triplet (called a codon) specifies a particular amino acid. Furthermore, it was shown that the codons do not overlap with each other in...

aaa (aaa water treader), an insect from Hawaii Triple-A syndrome AAA, a codon for the amino acid lysine Anti-amyloid drugs, also known as anti-amyloid...

is often not affected by introducing point mutations and premature stop codons. ncRNAs are also thought to regulate gene expression, so deletion studies...

Smillie KJ, Mason JI (June 2002). "A novel nonstop mutation in the stop codon and a novel missense mutation in the type II 3beta-hydroxysteroid dehydrogenase...

1186/1471-2164-12-87. PMC 3039613. PMID 21276262. Crick FH (August 1966). "Codon--anticodon pairing: the wobble hypothesis" (PDF). Journal of Molecular Biology...

techniques to experience structural evolutions in 3D architecture. These include codon usage frequency similarity (CUFS), paralog gene co-regulation, and spatially...

SOD1 may be significant factor in the etiology of ALS. A4V (alanine at codon 4 changed to valine) is the most common ALS-causing mutation in the U.S...

Position Original Nucleotide SNP Original Amino Acid Variant Amino Acid Codon 328 1212 T T Ser [S] Leu [L] 2 399 1424 G A Gly [G] Ser [S] 1 406 1446 C...

first worked at the biotechnology company Armos Corporation then Codon Corporation. Codon was purchased by Schering AG and became Berlex Biosciences. In...

that translation of this mRNA initiates exclusively at a non-AUG (GUG) codon. Alternatively spliced transcript variants encoding different isoforms of...

contributed to basic methods used in evolutionary studies, such as the codon model of evolution. Later he characterized important epigenetic phenomena...

the AUA codon in many archaea and is required for aminoacylation of tRNAIle2 with isoleucine. The genetic code describes how triplet codons on mRNA are...

primordial genetic sequences, the random occurrence of the 3 stop codons out of 64 codons would limit the open reading frames (ORFs) to a very short length...

If an editing site occurs within a coding sequence, it can result in a codon change. This can lead to translation of a protein isoform due to a change...

14 not available") type: CDS location: [6115:6421](+) qualifiers: Key: codon_start, Value: ['1'] Key: inference, Value: ['COORDINATES: similar to AA...

tryptophan (Trp) for propagation were isolated. As Trp is only coded by a single codon, there is evidence that Trp can be displaced by 4FTrp in the genetic code...

are primarily insertion/deletion mutations that result in premature stop codons. It is hypothesized that these mutations occurred in cetaceans already possessing...

within the unusually long sequence of this gene can cause premature stop codons or other defects. Titin mutations are associated with hereditary myopathy...

triplet nature of the genetic code and allowed the remaining ambiguous codons in the genetic code to be deciphered. In this experiment, using a ribosome...