Search Results: File:Consensus Flowchart ja.svg

Sorry, the article you're looking for isn't specifically available. Here are related topics:


File:20201209 Academic studies of scientific consensus - global warming, climate change-en.svg
Jumat, 2026-01-09 21:26:48

scientific consensus among publishing climatologists on human-caused global warming, based on data collected by Cook et al., "Consensus on Consensus" (2016)...

Click to read more »
File:Bangladesh Khelafat Majlis meeting with National Consensus Commission.jpg
Jumat, 2026-04-24 14:00:30

English Bangladesh Khelafat Majlis meeting with National Consensus Commission...

Click to read more »
File:20220629 Public estimates of scientific consensus on climate change - horizontal bar chart.svg
Jumat, 2026-01-09 21:38:24

Germany ≅ Germany (Q183) Germany Ireland ≅ Ireland (Q27) Ireland consensus ≅ consensus (Q202722) consensus climate change ≅ global warming (Q7942) climate change...

Click to read more »
File:20210102 Academic studies of scientific consensus - global warming, climate change-en GIF.gif
Jumat, 2026-01-09 21:26:48

20211103 Academic studies of scientific consensus - global warming, climate change - vertical bar chart - en.svg (different representation of same data...

Click to read more »
File:Cook et al. (2016) Studies consensus.jpg
Minggu, 2024-04-14 01:27:00

of consensus correlates with expertise in climate science. A 2019 study found scientific consensus to be at 100%. (2016). "Consensus on consensus: a synthesis...

Click to read more »
File:Consensus Flowchart.svg
Senin, 2024-12-09 01:12:02

text: Image of a process flowchart. The start symbol is labeled "Previous consensus" with an arrow pointing to "Make an edit", then to "Wait", then to a decision...

Click to read more »
File:Vuitton et al - International consensus on terminology - parasite200043-fig1.png
Senin, 2024-02-05 15:43:59

English Time schedule and main activities within the “Formal consensus” process for the definition of the terminology of echinococcosis....

Click to read more »
File:Consensus with just one oval.svg
Jumat, 2024-04-12 08:39:51

Based on Image:Consensus plain.svg (w:User:Kim Bruning) and Image:Consensus plain 2.svg See w:Wikipedia_talk:Consensus Made in w:Inkscape. Author: w:User:Omegatron...

Click to read more »
File:Bangladesh Nezame Islam Party (Izhar) submitted their reform proposal to the National Consensus Commission.jpg
Kamis, 2025-11-06 22:18:13

English Bangladesh Nezame Islam Party (Izhar) submitted their reform proposal to the National Consensus Commission...

Click to read more »
File:Consensus sequence.png
Senin, 2025-12-08 10:10:26

of this work, hereby publish it under the following license: English Consensus sequence example of four sequences author name string: RaffaPe Wikimedia...

Click to read more »
File:Sondages - consentement vs consensus PSL XXL.pdf
Sabtu, 2025-09-13 15:02:53

Attribution-Share Alike 4.0 truetrue English Sondages - consentement vs consensus PSL XXL - conférence du 8 décembre 2024 à Paris author name string: Natacha...

Click to read more »
File:Sondages - consentement vs consensus PSL XXL 1.pdf
Sabtu, 2025-12-20 05:30:48

Attribution-Share Alike 4.0 truetrue English French Sondages - consentement vs consensus PSL XXL 1 author name string: Natacha LSP Wikimedia username: Natacha...

Click to read more »
File:Consensus Flowchart APC.svg
Kamis, 2026-03-19 06:26:24

of this work, hereby publish it under the following license: English Consensus Flowchart author name string: HitomiAkane Wikimedia username: HitomiAkane...

Click to read more »
File:Consensus sequence of nucleotides.png
Selasa, 2025-12-16 22:17:48

work, hereby publish it under the following license: English Example of consensus sequence of nucleotides author name string: RaffaPe Wikimedia username:...

Click to read more »
File:20211103 Academic studies of scientific consensus - global warming, climate change - vertical bar chart - pl.svg
Jumat, 2026-01-09 21:26:49

and adding horizontal lines to visually draw together Consensus on Consensus . . . making consensus numbers at same vertical level . . . 2021-11-03T05:38:16Z...

Click to read more »
File:Consensus Recommendations for NMDARE in children RUS.pdf
Jumat, 2024-04-12 08:39:17

BY 4.0 Creative Commons Attribution 4.0 truetrue English International Consensus Recommendations for the Treatment of Pediatric NMDAR Antibody Encephalitis...

Click to read more »
File:Rep. Chris Shays Discusses Bipartisan Consensus on the September 11 Commission Recommendations.ogg
Kamis, 2024-10-17 12:45:39

English Rep. Chris Shays Discusses Bipartisan Consensus on the September 11 Commission Recommendations...

Click to read more »
File:20211103 Academic studies of scientific consensus - global warming, climate change - vertical bar chart - cs.svg
Jumat, 2026-01-09 21:38:21

20210102 Academic studies of scientific consensus - global warming, climate change-en GIF.gif (different representation of same data as of 2021-11-03)...

Click to read more »
File:Consensus sequence example.png
Selasa, 2025-12-16 22:17:47

work, hereby publish it under the following license: English Example of consensus sequence of four nucleotide sequences author name string: RaffaPe Wikimedia...

Click to read more »
File:Concentric consensus.png
Minggu, 2024-08-18 04:56:33

Domain Mark 1.0falsefalse English Two lines concentrically converged to a consensus. c applies to jurisdiction: United States determination method or standard:...

Click to read more »
File:Ngram for "scientific consensus on climate change".png
Senin, 2024-11-18 06:50:06

English Ngram graph showing frequency the phrase, "scientific consensus on climate change", has appeared in books since 1975. author name string: Markworthen...

Click to read more »
File:Consensus New.png
Jumat, 2024-04-12 08:39:15

הוראות עריכה. |מקור=היוצרים המקוריים מפורטים בדף התרשים המתורגם: [[:תמונה:Consensus new and old-he.svg]] |תאריך יצירה=11 English determination method or standard:...

Click to read more »
File:CPIC Term Consensus Table.jpg
Minggu, 2025-10-26 01:02:10

org/licenses/by/4.0CC BY 4.0 Creative Commons Attribution 4.0 truetrue English Final consensus terms for allele functional status and phenotype determination method...

Click to read more »
File:Ludger Kühnhardt, Africa Consensus. New Interests, Initiatives, and Partners, Washington D.C. and Baltimore (2014).jpg
Kamis, 2026-04-23 01:39:08

under the following license: English German Ludger Kühnhardt, Africa Consensus. New Interests, Initiatives, and Partners, Washington D.C. and Baltimore...

Click to read more »
File:Yaroslav Ivanov, Co-Founder and CVO of ALTA Blockchain Labs in Consensus 2024 by CoinDesk (54820486293).jpg
Sabtu, 2026-05-09 02:10:56

English Yaroslav Ivanov, co-founder and CVO of ALTA Blockchain Labs, during a meeting at Consensus 2024 determination method or standard: SHA-1...

Click to read more »
File:Signing Ceremony of the ASEAN Consensus on the Protection and Promotion of the Rights of Migrant Workers - Manila, Philippines - 14 November 2017.webm
Selasa, 2025-10-14 09:50:55

English Signing Ceremony of the ASEAN Consensus on the Protection and Promotion of the Rights of Migrant Workers during the 31st ASEAN Summit in Manila...

Click to read more »
File:20211103 Academic studies of scientific consensus - global warming, climate change - vertical bar chart - en.svg
Jumat, 2026-01-09 21:38:21

20210102 Academic studies of scientific consensus - global warming, climate change-en GIF.gif (different representation of same data as of 2021-11-03)...

Click to read more »
File:Chromopsin Consensus Sequence Logos.svg
Selasa, 2024-03-05 20:18:20

org/licenses/by/4.0CC BY 4.0 Creative Commons Attribution 4.0 truetrue English Consensus sequence logos of the chromopsins determination method or standard: SHA-1...

Click to read more »
File:Consensus plain.svg
Jumat, 2024-04-12 08:39:42

same name. Text from enwiki below. Author: Kim Bruning, first draft of consensus process... I, the copyright holder of this work, hereby publish it under...

Click to read more »
File:BRD in Hebrew.jpg
Rabu, 2023-10-11 09:13:53

This image is a derivative work of the following images: File:Consensus_New.png licensed with Cc-by-sa-3.0, GFDL 2012-01-06T08:05:30Z Matanya 610x900...

Click to read more »
File:Communist Party of Bangladesh Presents Reform Views to National Consensus Commission Vice-President Professor Ali Riaz Dhaka 2025-03-23 (PID-0002823).jpg
Selasa, 2026-01-27 03:31:28

English Communist Party of Bangladesh Presents Reform Views to National Consensus Commission Vice-President Professor Ali Riaz Dhaka 2025-03-23 Bangla জাতীয়...

Click to read more »
File:Consensus Flowchart-kn.svg
Jumat, 2024-04-12 08:39:01

org/licenses/by-sa/4.0CC BY-SA 4.0 Creative Commons Attribution-Share Alike 4.0 truetrue English Consensus flow chart determination method or standard: SHA-1...

Click to read more »
File:Calling for consensus demonstration in front of Beit HaNassi 01.jpg
Sabtu, 2023-11-18 18:41:42

BY 4.0 Creative Commons Attribution 4.0 truetrue English calling for consensus demonstration in front of Beit HaNassi author name string: Nizzan Cohen...

Click to read more »
File:Scientists' consensus statements regarding light and circadian rythms in health.jpg
Selasa, 2024-04-16 09:41:51

BY 4.0 Creative Commons Attribution 4.0 truetrue English From the study "Lights should support circadian rhythms: evidence-based scientific consensus"...

Click to read more »
File:Consensus Flowchart-bn.svg
Rabu, 2024-11-20 01:00:16

org/licenses/by-sa/4.0CC BY-SA 4.0 Creative Commons Attribution-Share Alike 4.0 truetrue English Consensus Flowchart determination method or standard: SHA-1...

Click to read more »
File:SmY-structure.png
Kamis, 2023-01-05 03:13:13

bytes) Consensus secondary structure of SmY RNAs. Sean R. Eddy; public domain. 2008-11-15 17:33 Seaneddy 800×254× (28504 bytes) SmY RNA consensus structure...

Click to read more »
File:Consensus Decision-making.pdf
Selasa, 2024-04-30 04:50:46

org/licenses/by-sa/4.0CC BY-SA 4.0 Creative Commons Attribution-Share Alike 4.0 truetrue English Consensus Decision-making determination method or standard: SHA-1...

Click to read more »
File:Consensus 2025 - Eric Trump 09.jpg
Selasa, 2025-12-16 22:17:33

Creative Commons Attribution-Share Alike 4.0 truetrue English Eric Trump at Consensus 2025 in Toronto (May 15, 2025) author name string: Xuthoria Wikimedia...

Click to read more »
File:Consensus 2025 - Eric Trump 03.jpg
Jumat, 2026-05-15 03:31:20

Creative Commons Attribution-Share Alike 4.0 truetrue English Eric Trump at Consensus 2025 in Toronto (May 15, 2025) author name string: Xuthoria Wikimedia...

Click to read more »
File:Consensus 2025 - Eric Trump 10.jpg
Selasa, 2025-12-16 22:17:34

Creative Commons Attribution-Share Alike 4.0 truetrue English Eric Trump at Consensus 2025 in Toronto (May 15, 2025) author name string: Xuthoria Wikimedia...

Click to read more »
File:Consenso nuevo y antiguo.svg
Selasa, 2025-12-16 22:17:19

Based on en:Image:Consensus plain.svg (en:User:Kim Bruning) and en:Image:Consensus plain 2.svg and en:Image:Consensus with just one oval.svg Author: en:User:Omegatron...

Click to read more »
File:Consensus 2025 - Eric Trump 06.jpg
Jumat, 2026-05-15 03:31:20

Creative Commons Attribution-Share Alike 4.0 truetrue English Eric Trump at Consensus 2025 in Toronto (May 16, 2025) author name string: Xuthoria Wikimedia...

Click to read more »
File:Consensus 2025 - Eric Trump 01.jpg
Jumat, 2026-05-15 03:31:20

Creative Commons Attribution-Share Alike 4.0 truetrue English Eric Trump at Consensus 2025 in Toronto (May 15, 2025) author name string: Xuthoria Wikimedia...

Click to read more »
File:Consensus 2025 - Bo Hines 02.jpg
Senin, 2026-05-25 07:57:27

Commons Attribution-Share Alike 4.0 truetrue English Robert "Bo" Hines at Consensus 2025 in Toronto author name string: Xuthoria Wikimedia username: Xuthoria...

Click to read more »
File:Études académiques sur le consensus scientifique.svg
Sabtu, 2026-01-03 19:41:45

Attribution-Share Alike 4.0 truetrue English French Études académiques sur le consensus scientifique author name string: RCraig09 URL: https://commons.wikimedia...

Click to read more »
File:Udi Leon in the Consensus Tent hunger strike.jpg
Senin, 2024-06-03 03:31:41

4.0 Creative Commons Attribution 4.0 truetrue English Udi Leon in the Consensus Tent hunger strike author name string: Nizzan Cohen Wikimedia username:...

Click to read more »
File:Consensus 2026 - Tom Lee 02.jpg
Minggu, 2026-05-24 11:43:44

0 Creative Commons Attribution-Share Alike 4.0 truetrue English Tom Lee speaking at Consensus Hong Kong 2026 determination method or standard: SHA-1...

Click to read more »
File:Consensus plain 2.svg
Jumat, 2024-04-12 08:39:43

Based on Image:Consensus plain.svg (w:User:Kim Bruning) Made in w:Inkscape. Author: w:User:Omegatron I, the copyright holder of this work, hereby publish...

Click to read more »
File:Consensus 2025 - Bo Hines 01.jpg
Senin, 2026-05-25 07:57:27

Commons Attribution-Share Alike 4.0 truetrue English Robert "Bo" Hines at Consensus 2025 in Toronto author name string: Xuthoria Wikimedia username: Xuthoria...

Click to read more »
File:Build consensus flow-chart Zh-hant.png
Minggu, 2023-12-31 04:02:05

Alike 3.0 truetrue English Chinese (China) A Chinese translated version of [[:File:Consensus-flowchart.png]] determination method or standard: SHA-1...

Click to read more »
File:Consensus 2025 - Eric Trump 02.jpg
Jumat, 2026-05-15 03:31:20

Creative Commons Attribution-Share Alike 4.0 truetrue English Eric Trump at Consensus 2025 in Toronto (May 15, 2025) author name string: Xuthoria Wikimedia...

Click to read more »
File:Raft Consensus Algorithm Mascot with Background.svg
Kamis, 2025-05-15 15:18:19

Creative Commons Attribution-Share Alike 4.0 truetrue English The Raft consensus algorithm logo, a log raft with a face. determination method or standard:...

Click to read more »
File:Consensus 2022, Cardano.jpg
Jumat, 2024-04-12 08:38:51

BY-SA 4.0 Creative Commons Attribution-Share Alike 4.0 truetrue English Consensus 2022, Cardano object of statement has role: photographer author name string:...

Click to read more »
File:2017 WMCON - Consensus-Building in Organizational Development.pdf
Selasa, 2025-07-08 06:44:05

Description2017 WMCON - Consensus-Building in Organizational Development.pdf English: Consensus-Building in Organizational Development by Rosie Stephenson-Goodknight...

Click to read more »
File:Mir-3180 consensus structure.png
Sabtu, 2026-05-02 23:54:50

BY-SA 4.0 Creative Commons Attribution-Share Alike 4.0 truetrue English A consensus secondary structure for the microRNA mir-3180. determination method or...

Click to read more »
File:Consensus 2025 - Eric Trump 05.jpg
Jumat, 2026-05-15 03:31:20

Creative Commons Attribution-Share Alike 4.0 truetrue English Eric Trump at Consensus 2025 in Toronto (May 16, 2025) author name string: Xuthoria Wikimedia...

Click to read more »
File:Oxalis palmifrons consensus tree.jpg
Jumat, 2025-05-09 01:11:28

Commons Attribution-Share Alike 4.0 truetrue English Bayesian majority-rule consensus tree of the O. tomentosa alliance and outgroups. determination method...

Click to read more »
File:Consensus 2026 - Tom Lee 09.jpg
Minggu, 2026-05-24 11:44:16

0 Creative Commons Attribution-Share Alike 4.0 truetrue English Tom Lee speaking at Consensus Hong Kong 2026 determination method or standard: SHA-1...

Click to read more »
File:July Charter Meeting.jpg
Rabu, 2026-01-28 03:21:07

Meeting of the National Consensus Commission on the Consolidated Draft of the July National Charter at the National Consensus Commission office at the...

Click to read more »
File:Consensus 2025 - Eric Trump 07.jpg
Jumat, 2026-05-15 03:31:21

Creative Commons Attribution-Share Alike 4.0 truetrue English Eric Trump at Consensus 2025 in Toronto (May 16, 2025) author name string: Xuthoria Wikimedia...

Click to read more »
File:Consensus 2025 - Bo Hines 03.jpg
Senin, 2026-05-25 07:57:28

Commons Attribution-Share Alike 4.0 truetrue English Robert "Bo" Hines at Consensus 2025 in Toronto author name string: Xuthoria Wikimedia username: Xuthoria...

Click to read more »
File:Consensus 2025 - Eric Trump 04.jpg
Jumat, 2026-05-15 03:31:21

Creative Commons Attribution-Share Alike 4.0 truetrue English Eric Trump at Consensus 2025 in Toronto (May 15, 2025) author name string: Xuthoria Wikimedia...

Click to read more »
File:Consensus 2025 - Eric Trump 08.jpg
Jumat, 2026-05-15 03:31:21

Creative Commons Attribution-Share Alike 4.0 truetrue English Eric Trump at Consensus 2025 in Toronto (May 16, 2025) author name string: Xuthoria Wikimedia...

Click to read more »
File:Discussing consensus and hegemony.jpg
Jumat, 2026-05-01 10:05:45

Creative Commons Attribution-Share Alike 4.0 truetrue English Discussing consensus and hegemony object of statement has role: photographer author name string:...

Click to read more »
File:2017 Wikimania - Group Consensus-Building.pdf
Senin, 2026-02-09 02:38:12

Description2017 Wikimania - Group Consensus-Building.pdf English: Group Consensus-Building - Wikimania 2017 Learning Days - Montreal, Quebec, Canada 日本語:...

Click to read more »
File:Consensus 2026 - Ben Goertzel 05.jpg
Minggu, 2026-05-24 11:42:28

BY-SA 4.0 Creative Commons Attribution-Share Alike 4.0 truetrue English Ben Goertzel at Consensus Hong Kong 2026 determination method or standard: SHA-1...

Click to read more »
File:Consensus 2026 - Anthony Scaramucci 05.jpg
Minggu, 2026-05-24 11:42:09

Creative Commons Attribution-Share Alike 4.0 truetrue English Anthony Scaramucci at Consensus 2026 in Hong Kong determination method or standard: SHA-1...

Click to read more »
File:Consensus 2026 - Charles Hoskinson 06.jpg
Minggu, 2026-05-24 11:42:51

0 Creative Commons Attribution-Share Alike 4.0 truetrue English Charles Hoskinson at Consensus Hong Kong 2026 determination method or standard: SHA-1...

Click to read more »
File:100% Consensus.jpg
Senin, 2023-03-13 22:26:33

org/licenses/by/4.0CC BY 4.0 Creative Commons Attribution 4.0 truetrue English The consensus on anthropogenic global warming has now reached 100%. author name string:...

Click to read more »
File:Consensus Tent hunger stike in demend to hold the judicial reform and negotiation.jpg
Senin, 2024-06-03 03:31:45

org/licenses/by/4.0CC BY 4.0 Creative Commons Attribution 4.0 truetrue English Consensus Tent hunger stike in demend to hold the judicial reform and negotiation...

Click to read more »
File:Raft Consensus Algorithm Mascot on transparent background.svg
Jumat, 2026-05-22 12:17:01

Creative Commons Attribution-Share Alike 4.0 truetrue English The Raft consensus algorithm logo, a log raft with a face. determination method or standard:...

Click to read more »
File:Strict consensus of 3 maximum parsimony trees resulted from the present analysis.tif
Selasa, 2026-03-24 11:35:52

org/licenses/by/4.0CC BY 4.0 Creative Commons Attribution 4.0 truetrue English Strict consensus of 3 maximum parsimony trees resulted from the present analysis. determination...

Click to read more »
File:Consensus 2026 - Charles Hoskinson 04.jpg
Minggu, 2026-05-24 11:42:41

0 Creative Commons Attribution-Share Alike 4.0 truetrue English Charles Hoskinson at Consensus Hong Kong 2026 determination method or standard: SHA-1...

Click to read more »
File:Top consensus statements regarding light and circadian rythms in health (by level of support).jpg
Selasa, 2024-04-16 07:38:36

BY 4.0 Creative Commons Attribution 4.0 truetrue English From the study "Lights should support circadian rhythms: evidence-based scientific consensus"...

Click to read more »
File:Esquema consenso2.svg
Kamis, 2026-05-28 04:19:32

Descrição do ficheiro == diagram about consensus process Based on http://en.wikipedia.org/wiki/Image:Consensus_new_and_old.svg (author: http://en.wikipedia...

Click to read more »
File:Consensus 2026 - Ben Goertzel 01.jpg
Minggu, 2026-05-24 11:42:14

BY-SA 4.0 Creative Commons Attribution-Share Alike 4.0 truetrue English Ben Goertzel at Consensus Hong Kong 2026 determination method or standard: SHA-1...

Click to read more »
File:Consensus 2026 - Ben Goertzel 03.jpg
Minggu, 2026-05-24 11:42:21

BY-SA 4.0 Creative Commons Attribution-Share Alike 4.0 truetrue English Ben Goertzel at Consensus Hong Kong 2026 determination method or standard: SHA-1...

Click to read more »
File:Consensus 2026 - Tom Lee 08.jpg
Minggu, 2026-05-24 11:44:13

0 Creative Commons Attribution-Share Alike 4.0 truetrue English Tom Lee speaking at Consensus Hong Kong 2026 determination method or standard: SHA-1...

Click to read more »
File:Consensus 2026 - Charles Hoskinson 05.jpg
Minggu, 2026-05-24 11:42:47

0 Creative Commons Attribution-Share Alike 4.0 truetrue English Charles Hoskinson at Consensus Hong Kong 2026 determination method or standard: SHA-1...

Click to read more »
File:Consensus 2026 - Tom Lee 01.jpg
Minggu, 2026-05-24 11:43:40

0 Creative Commons Attribution-Share Alike 4.0 truetrue English Tom Lee speaking at Consensus Hong Kong 2026 determination method or standard: SHA-1...

Click to read more »
File:Consensus 2026 - Tom Lee 06.jpg
Minggu, 2026-05-24 11:44:04

0 Creative Commons Attribution-Share Alike 4.0 truetrue English Tom Lee speaking at Consensus Hong Kong 2026 determination method or standard: SHA-1...

Click to read more »
File:Consensus 2026 - Ben Goertzel 04.jpg
Minggu, 2026-05-24 11:42:24

BY-SA 4.0 Creative Commons Attribution-Share Alike 4.0 truetrue English Ben Goertzel at Consensus Hong Kong 2026 determination method or standard: SHA-1...

Click to read more »
File:Consensus 2026 - Tom Lee 10.jpg
Minggu, 2026-05-24 11:44:20

0 Creative Commons Attribution-Share Alike 4.0 truetrue English Tom Lee speaking at Consensus Hong Kong 2026 determination method or standard: SHA-1...

Click to read more »
File:Consensus Tent hunger stike in demend to hold the judicial reform and negotiation 01.jpg
Senin, 2024-06-03 03:31:43

org/licenses/by/4.0CC BY 4.0 Creative Commons Attribution 4.0 truetrue English Consensus Tent hunger stike in demend to hold the judicial reform and negotiation...

Click to read more »
File:Consensus 2026 - Tom Lee 07.jpg
Minggu, 2026-05-24 11:44:08

0 Creative Commons Attribution-Share Alike 4.0 truetrue English Tom Lee speaking at Consensus Hong Kong 2026 determination method or standard: SHA-1...

Click to read more »
File:Statements regarding light and circadian rythms in health where subject-level scientists could not find consensus.jpg
Selasa, 2024-04-16 08:59:06

BY 4.0 Creative Commons Attribution 4.0 truetrue English From the study "Lights should support circadian rhythms: evidence-based scientific consensus"...

Click to read more »
File:Consensus 2026 - Charles Hoskinson 03.jpg
Selasa, 2026-05-12 00:46:26

Commons Attribution-Share Alike 4.0 truetrue English Charles Hoskinson at Consensus Hong Kong 2026 object of statement has role: photographer author name...

Click to read more »
File:Shibtoshi1.jpg
Jumat, 2026-04-10 00:27:40

English Abkhazian SquidGrow sponsored Karate Combat 46 at Consensus 2024 determination method or standard: SHA-1...

Click to read more »
File:Google-Trends-opinion-consensus-w-key.png
Kamis, 2023-11-02 14:17:51

Attribution-Share Alike 4.0 truetrue English Google Trends graph for "scientific consensus on climate change" Wikimedia username: Markworthen author name string:...

Click to read more »
File:Consensus Tent hunger stike in demend to hold the judicial reform and negotiation 02.jpg
Senin, 2024-06-03 03:31:40

org/licenses/by/4.0CC BY 4.0 Creative Commons Attribution 4.0 truetrue English Consensus Tent hunger stike in demend to hold the judicial reform and negotiation...

Click to read more »
File:Consensus 2026 - Anthony Scaramucci 01.jpg
Minggu, 2026-05-24 11:41:57

Creative Commons Attribution-Share Alike 4.0 truetrue English Anthony Scaramucci at Consensus 2026 in Hong Kong determination method or standard: SHA-1...

Click to read more »
File:Consensus 2026 - Anthony Scaramucci 02.jpg
Minggu, 2026-05-24 11:42:02

Creative Commons Attribution-Share Alike 4.0 truetrue English Anthony Scaramucci at Consensus 2026 in Hong Kong determination method or standard: SHA-1...

Click to read more »
File:CDM-ngram.png
Rabu, 2024-01-17 06:34:35

hereby publish it under the following license: English Relative use of "consensus decsion-making" over time. author name string: Douginamug Wikimedia username:...

Click to read more »
File:Consensus 2026 - Paul Chan Mo-po 03.jpg
Minggu, 2026-05-24 11:43:25

4.0 Creative Commons Attribution-Share Alike 4.0 truetrue English Paul Chan Mo-po at Consensus Hong Kong 2026 determination method or standard: SHA-1...

Click to read more »
File:Prof Meir Buzaglo and Prof Hanoh Ben Pazi in the Consensus Tent.jpg
Senin, 2024-06-03 03:31:42

4.0 truetrue English Prof Meir Buzaglo and Prof Hanoh Ben Pazi in the Consensus Tent object of statement has role: photographer author name string: Nizzan...

Click to read more »
File:Consensus 2026 - Julia Leung Fung-yee 02.jpg
Minggu, 2026-05-24 11:43:04

Creative Commons Attribution-Share Alike 4.0 truetrue English Julia Leung Fung-yee at Consensus Hong Kong 2026 determination method or standard: SHA-1...

Click to read more »
File:Consensus 2026 - Julia Leung Fung-yee 03.jpg
Minggu, 2026-05-24 11:43:07

Creative Commons Attribution-Share Alike 4.0 truetrue English Julia Leung Fung-yee at Consensus Hong Kong 2026 determination method or standard: SHA-1...

Click to read more »
File:Старый и новый консенсус.png
Rabu, 2025-02-05 06:16:25

English Consensus new and old; gender-neutral in Russian now determination method or standard: SHA-1...

Click to read more »
File:Consensus Tent hunger stike in demend to hold the judicial reform and negotiation 04.jpg
Senin, 2024-06-03 03:31:46

org/licenses/by/4.0CC BY 4.0 Creative Commons Attribution 4.0 truetrue English Consensus Tent hunger stike in demend to hold the judicial reform and negotiation...

Click to read more »
File:Discussions between various political parties on ways to implement the July National Charter 2025 were held with the National Consensus Commission at the Foreign Service Academy in Dhaka, 17 September 2025.jpg
Jumat, 2026-05-01 10:24:49

implement the July National Charter 2025 were held with the National Consensus Commission today at the Foreign Service Academy in Dhaka (Wednesday, 17...

Click to read more »
File:BRD1.svg
Rabu, 2023-10-11 09:05:32

(48863 bytes) Illustration for BRD, showing what it does, and how it relates to the consensus process English determination method or standard: SHA-1...

Click to read more »
File:Consensus 2026 - Charles Hoskinson 01.jpg
Minggu, 2026-05-24 11:42:33

0 Creative Commons Attribution-Share Alike 4.0 truetrue English Charles Hoskinson at Consensus Hong Kong 2026 determination method or standard: SHA-1...

Click to read more »
File:Consensus 2026 - Tom Lee 05.jpg
Minggu, 2026-05-24 11:44:00

0 Creative Commons Attribution-Share Alike 4.0 truetrue English Tom Lee speaking at Consensus Hong Kong 2026 determination method or standard: SHA-1...

Click to read more »
File:Consensus 2026 - Tom Lee 12.jpg
Minggu, 2026-05-24 11:44:27

0 Creative Commons Attribution-Share Alike 4.0 truetrue English Tom Lee speaking at Consensus Hong Kong 2026 determination method or standard: SHA-1...

Click to read more »
File:Consensus 2026 - Paul Chan Mo-po 07.jpg
Minggu, 2026-05-24 11:43:37

4.0 Creative Commons Attribution-Share Alike 4.0 truetrue English Paul Chan Mo-po at Consensus Hong Kong 2026 determination method or standard: SHA-1...

Click to read more »
File:Consensus - Medicinska fakultetens studentkårs logga.png
Jumat, 2024-04-12 08:38:50

org/licenses/by-sa/4.0CC BY-SA 4.0 Creative Commons Attribution-Share Alike 4.0 truetrue English Consensus logga determination method or standard: SHA-1...

Click to read more »
File:Consensus 2026 - Tom Lee 04.jpg
Minggu, 2026-05-24 11:43:56

0 Creative Commons Attribution-Share Alike 4.0 truetrue English Tom Lee speaking at Consensus Hong Kong 2026 determination method or standard: SHA-1...

Click to read more »
File:Consensus 2026 - Julia Leung Fung-yee 01.jpg
Minggu, 2026-05-24 11:42:59

Creative Commons Attribution-Share Alike 4.0 truetrue English Julia Leung Fung-yee at Consensus Hong Kong 2026 determination method or standard: SHA-1...

Click to read more »
File:Consensus 2026 - Ben Goertzel 02.jpg
Minggu, 2026-05-24 11:42:17

BY-SA 4.0 Creative Commons Attribution-Share Alike 4.0 truetrue English Ben Goertzel at Consensus Hong Kong 2026 determination method or standard: SHA-1...

Click to read more »
File:Consensus 2026 - Anthony Scaramucci 04.jpg
Minggu, 2026-05-24 11:42:05

Creative Commons Attribution-Share Alike 4.0 truetrue English Anthony Scaramucci at Consensus 2026 in Hong Kong determination method or standard: SHA-1...

Click to read more »
File:Consensus 2026 - Tom Lee 03.jpg
Minggu, 2026-05-24 11:43:48

0 Creative Commons Attribution-Share Alike 4.0 truetrue English Tom Lee speaking at Consensus Hong Kong 2026 determination method or standard: SHA-1...

Click to read more »
File:Consensus 2026 - Tom Lee 11.jpg
Minggu, 2026-05-24 11:44:23

0 Creative Commons Attribution-Share Alike 4.0 truetrue English Tom Lee speaking at Consensus Hong Kong 2026 determination method or standard: SHA-1...

Click to read more »
File:Protist-life-cycles-consensus.png
Kamis, 2025-01-30 01:57:49

BY-SA 4.0 Creative Commons Attribution-Share Alike 4.0 truetrue English Consensus life cycle of free-living protists author name string: Snoteleks Wikimedia...

Click to read more »
File:Consensus 2026 - Paul Chan Mo-po 05.jpg
Selasa, 2026-05-12 00:46:28

4.0 Creative Commons Attribution-Share Alike 4.0 truetrue English Paul Chan Mo-po at Consensus Hong Kong 2026 determination method or standard: SHA-1...

Click to read more »
File:Consensus 2026 - Paul Chan Mo-po 01.jpg
Minggu, 2026-05-24 11:43:14

4.0 Creative Commons Attribution-Share Alike 4.0 truetrue English Paul Chan Mo-po at Consensus Hong Kong 2026 determination method or standard: SHA-1...

Click to read more »
File:Consensus 2025 - Bo Hines 02 (cropped).jpg
Rabu, 2026-03-11 10:58:11

Creative Commons Attribution-Share Alike 4.0 truetrue English Bo Hines at Consensus 2025 (May 14, 2025) author name string: Xuthoria Wikimedia username: Xuthoria...

Click to read more »
File:Jeanne Shaheen (United States Senator) at a panel discussion on "A New Trans-Atlantic Consensus" moderated by Dutch journalist Rick Nieman at a NATO Public Forum on 24 June 2025.jpg
Selasa, 2026-02-17 21:06:54

(United States Senator) at a panel discussion on "A New Trans-Atlantic Consensus" moderated by Dutch journalist Rick Nieman at a NATO Public Forum on 24...

Click to read more »
File:Consensus Tent hunger stike in demend to hold the judicial reform and negotiation 23 march 2023.jpg
Senin, 2024-06-03 03:31:37

org/licenses/by/4.0CC BY 4.0 Creative Commons Attribution 4.0 truetrue English Consensus Tent hunger stike in demend to hold the judicial reform and negotiation...

Click to read more »
File:Consensus 2026 - Julia Leung Fung-yee 04.jpg
Minggu, 2026-05-24 11:43:11

Creative Commons Attribution-Share Alike 4.0 truetrue English Julia Leung Fung-yee at Consensus Hong Kong 2026 determination method or standard: SHA-1...

Click to read more »
File:Consensus 2026 - Paul Chan Mo-po 06.jpg
Minggu, 2026-05-24 11:43:33

4.0 Creative Commons Attribution-Share Alike 4.0 truetrue English Paul Chan Mo-po at Consensus Hong Kong 2026 determination method or standard: SHA-1...

Click to read more »
File:Consensus Tent hunger stike in demend to hold the judicial reform and negotiation 05.jpg
Senin, 2024-06-03 03:31:47

org/licenses/by/4.0CC BY 4.0 Creative Commons Attribution 4.0 truetrue English Consensus Tent hunger stike in demend to hold the judicial reform and negotiation...

Click to read more »
File:Consensus 2026 - Charles Hoskinson 02.jpg
Minggu, 2026-05-24 11:42:37

Commons Attribution-Share Alike 4.0 truetrue English Charles Hoskinson at Consensus Hong Kong 2026 object of statement has role: photographer author name...

Click to read more »
File:Consensus 2026 - Paul Chan Mo-po 02.jpg
Minggu, 2026-05-24 11:43:21

4.0 Creative Commons Attribution-Share Alike 4.0 truetrue English Paul Chan Mo-po at Consensus Hong Kong 2026 determination method or standard: SHA-1...

Click to read more »
File:Consensus 2026 - Anthony Scaramucci 03.jpg
Selasa, 2026-05-12 00:46:24

Commons Attribution-Share Alike 4.0 truetrue English Anthony Scaramucci at Consensus 2026 in Hong Kong object of statement has role: photographer author name...

Click to read more »
File:Consensus Tent hunger stike in demend to hold the judicial reform and negotiation 06.jpg
Senin, 2024-06-03 03:31:48

org/licenses/by/4.0CC BY 4.0 Creative Commons Attribution 4.0 truetrue English Consensus Tent hunger stike in demend to hold the judicial reform and negotiation...

Click to read more »
File:Consenso-vec.png
Kamis, 2026-06-04 05:00:08

I, the copyright holder of this work, hereby publish it under the following license: English Consensus flow-chart...

Click to read more »
File:Consensus 2026 - Paul Chan Mo-po 04.jpg
Minggu, 2026-05-24 11:43:29

4.0 Creative Commons Attribution-Share Alike 4.0 truetrue English Paul Chan Mo-po at Consensus Hong Kong 2026 determination method or standard: SHA-1...

Click to read more »
File:Consensus Tent hunger stike in demend to hold the judicial reform and negotiation 03.jpg
Senin, 2024-06-03 03:31:44

org/licenses/by/4.0CC BY 4.0 Creative Commons Attribution 4.0 truetrue English Consensus Tent hunger stike in demend to hold the judicial reform and negotiation...

Click to read more »
File:Protist life cycle consensus.svg
Senin, 2026-06-01 09:16:45

BY-SA 4.0 Creative Commons Attribution-Share Alike 4.0 truetrue English Consensus of the life cycle of free-living single-celled protists, showing the full...

Click to read more »
File:Time-calibrated majority-rules consensus tree showing the position of Eoneophron infernalis - Journal.pone.0294901.g009.tif
Jumat, 2025-10-24 01:47:17

Commons Attribution 4.0 truetrue English Time-calibrated majority-rules consensus tree showing the position of Eoneophron infernalis determination method...

Click to read more »
File:PDB 2avp EBI.jpg
Selasa, 2026-03-31 02:06:27

domain-based design • Family: TPR domain-based design • Protein Domain: An 8 repeat consensus TPR superhelix English determination method or standard: SHA-1...

Click to read more »
File:Wikimania 2023 reaching consensus.jpg
Sabtu, 2025-12-20 00:02:36

Commons Attribution-Share Alike 4.0 truetrue English Wikimanians reaching consensus within Wikeys author name string: Tamsin Braisher Wikimedia username:...

Click to read more »
File:PDB 2q7f EBI.png
Jumat, 2009-06-12 10:36:24

TPR domain-based design • Superfamily: TPR domain-based design • Family: TPR domain-based design • Protein Domain: An 8 repeat consensus TPR superhelix...

Click to read more »
File:Seven of Charles Crowley's picks for All-American football team in 1925.jpg
Sabtu, 2025-12-13 07:11:03

English 1925 photographs of seven football players (Andy Oberlander, Red Grange, and Bennie Oosterbann were the only consensus All-Americans out of the 7)...

Click to read more »
File:PDB 2vgx EBI.png
Jumat, 2009-06-12 10:36:26

TPR domain-based design • Superfamily: TPR domain-based design • Family: TPR domain-based design • Protein Domain: An 8 repeat consensus TPR superhelix...

Click to read more »
File:The emergence of consensus - a primer.pdf
Minggu, 2025-04-20 03:52:16

DescriptionThe emergence of consensus - a primer.pdf English: Baronchelli, Andrea (2018). "The emergence of consensus: a primer". Royal Society Open Science...

Click to read more »
File:PDB 2fo7 EBI.jpg
Kamis, 2026-03-05 13:24:18

domain-based design • Family: TPR domain-based design • Protein Domain: An 8 repeat consensus TPR superhelix English determination method or standard: SHA-1...

Click to read more »
File:Kjell Magne Bondevik during Ukraine Week at the European Parliament.jpg
Rabu, 2026-02-11 10:46:27

reform-high-level-discussion-the-role-of-political-groups-towards-a-political-culture-of-consensus-and-coalition-building_20160301_EP-031933G_PGC_254...

Click to read more »
File:Map by M. Lionel Bender and colleagues (1976) representing the consensus among ethnographers and linguists about the approximate extent of the Tigrinya language.jpg
Selasa, 2026-01-20 22:37:29

English Map by M. Lionel Bender and colleagues (1976) representing the consensus among ethnographers and linguists about the approximate extent of the...

Click to read more »
File:2020 Консенсусное Руководство по Недостаточности BH4.pdf
Kamis, 2023-05-11 04:12:32

BY-SA 4.0 Creative Commons Attribution-Share Alike 4.0 truetrue English Consensus guideline for the diagnosis and treatment of tetrahydrobiopterin (BH4)...

Click to read more »
File:Kjell Magne Bondevik during the Ukraine Week at the European Parliament.jpg
Rabu, 2026-02-11 10:47:20

reform-high-level-discussion-the-role-of-political-groups-towards-a-political-culture-of-consensus-and-coalition-building_20160301_EP-031933G_PGC_235...

Click to read more »
File:Kjell Magne Bondevik at Ukraine Week at the European Parliament.jpg
Rabu, 2026-02-11 10:45:36

reform-high-level-discussion-the-role-of-political-groups-towards-a-political-culture-of-consensus-and-coalition-building_20160301_EP-031933G_PGC_134...

Click to read more »
File:Guide to voting and consensus (WMUK 2016).pdf
Kamis, 2020-10-22 18:33:14

voting and consensus (WMUK 2016).pdf English: Presentation given to wmuk:AGM 2016 by User:Deryck Chan: "An admin's guide to voting and consensus", using...

Click to read more »
File:Consensus Values and Weighting Factors (IA jresv87n5p377 A1b).pdf
Minggu, 2024-08-18 12:54:55

Consensus Values and Weighting Factors   (  ) Author Paule, R.C. Mandel, J. Title Consensus Values and Weighting Factors Volume 87 Publisher National...

Click to read more »
File:Consensus values, regressions, and weighting factors (IA jresv94n3p197).pdf
Selasa, 2025-12-16 22:17:51

Consensus values, regressions, and weighting factors   (  ) Author Paule, R.C. Mandel, J. Title Consensus values, regressions, and weighting factors Volume...

Click to read more »
File:2010-2011 MENA protests deathtoll results.svg
Senin, 2025-03-24 04:37:14

(207151 Bytes) Consensus reached on Yemen government change 2011-03-21T13:39:57Z ZeLonewolf 800x575 (207012 Bytes) Please reach consensus at http://en.wikipedia...

Click to read more »
File:Social inhibition maintains adaptivity and consensus of honeybees foraging in dynamic environments.pdf
Minggu, 2025-04-20 02:45:56

DescriptionSocial inhibition maintains adaptivity and consensus of honeybees foraging in dynamic environments.pdf English: Bidari, Subekshya; Peleg, Orit;...

Click to read more »
File:Sondages - consentement vs consensus.pdf
Rabu, 2024-12-11 03:57:02

DescriptionSondages - consentement vs consensus.pdf Français : présentation sur les sondages sur wikipédia Date 8 December 2024 Source Own work Author...

Click to read more »
File:Communication speeds up but impairs the consensus decision in a dyadic colour estimation task.pdf
Jumat, 2025-12-12 15:22:44

DescriptionCommunication speeds up but impairs the consensus decision in a dyadic colour estimation task.pdf English: Yu, Liutao; Wang, Chundi; Wu, Si;...

Click to read more »
File:Link updating strategies influence consensus decisions as a function of the direction of communication.pdf
Sabtu, 2025-04-19 07:16:48

DescriptionLink updating strategies influence consensus decisions as a function of the direction of communication.pdf English: Kunjar, Sharaj; Strandburg-Peshkin...

Click to read more »
File:Nunavut Legislative Assembly - Seating Chart ᓄᓇᕗᒻᒥ ᒪᓕᒐᓕᐅᕐᕕᖕᒧᑦ ᑲᑎᒪᕝᕕᒃ − ᐊᑐᐃᓐᓇᕐᓄᑦ ᐸᕐᓇᐅᑎ.svg
Sabtu, 2025-07-12 12:52:11

English Seating plan of the Legislative Assembly of Nunavut. Nunavut uses a consensus-style government, and there are no political parties at a territorial...

Click to read more »
File:Building consensus for strategic planning and implementation for Coast Guard law enforcement (IA buildingconsensu00holm).pdf
Minggu, 2024-08-18 15:10:17

Building consensus for strategic planning and implementation for Coast Guard law enforcement   (  ) Author Holmgren, Jeffrey D.;Dolan, James R. Title...

Click to read more »
File:Kit body eng06away.png
Rabu, 2022-02-16 19:24:06

Not a V-neck 2009-01-13 18:41 PeeJay2K3 38×59× (3202 bytes) rm logo per consensus at [[WP:FOOTY]] 2007-08-21 19:45 Baddmind 38×59× (3288 bytes) English...

Click to read more »
File:Fourth annual report on Federal agency use of voluntary consensus standards (IA fourthannualrepo6846john).pdf
Sabtu, 2025-10-04 22:57:43

use of voluntary consensus standards   (  ) Author Johnsen, K. J. Title Fourth annual report on Federal agency use of voluntary consensus standards Volume...

Click to read more »
File:PopandPeck1918Owl.jpg
Selasa, 2025-12-23 02:58:34

with three-time All-American and team captain Bob Peck. Pitt was the consensus National Championship in 1916, going undefeated with 8-0 record and outscored...

Click to read more »
File:A weighted consensus approach to tropical cyclone 96-H and 120-H track forecasting (IA aweightedconsens109453594).pdf
Minggu, 2025-03-02 12:16:11

weighted consensus approach to tropical cyclone 96-H and 120-H track forecasting   (  ) Author Hughes, James R. Title A weighted consensus approach to...

Click to read more »
File:Breaking consensus - the occupation and the employment of the Israel Defense Forces (IA breakingconsensu109453316).pdf
Minggu, 2024-08-18 15:02:18

Breaking consensus : the occupation and the employment of the Israel Defense Forces   (  ) Author Scoratow, Leon B. Title Breaking consensus : the occupation...

Click to read more »
File:Travis Kriplean - Wikimania 2009 - tools for scaling consensus.pdf
Minggu, 2020-10-25 05:32:45

DescriptionTravis Kriplean - Wikimania 2009 - tools for scaling consensus.pdf English: Presentation for Wikimania 2009: Tools for Supporting Deliberation...

Click to read more »
File:Process for the recruitment of survey respondents of a survey study inquiring input of subjects-relevant scientists.jpg
Sabtu, 2025-12-27 13:04:40

truetrue English From the study "Lights should support circadian rhythms: evidence-based scientific consensus" determination method or standard: SHA-1...

Click to read more »
File:Seeking validation and consensus on slip-resistance measurements and standards (IA seekingvalidatio5988froh).pdf
Minggu, 2026-05-31 03:33:25

Seeking validation and consensus on slip-resistance measurements and standards   (  ) Author Frohnsdorff, Geoffrey J. Martin, Jonathan W. Title Seeking...

Click to read more »
File:CFLRP (Collaborative Forest Landscape Restoration Program) (20150812-FS-ElDorado-002).jpg
Kamis, 2026-05-07 15:06:51

4 March 2026 English The Amador-Calaveras Consensus Group Cornerstone Project in the Eldorado and Stanislaus National Forests, California. Photo of Indian...

Click to read more »
File:Consensus Flowchart-tag-mr.svg
Jumat, 2024-04-12 08:39:04

DescriptionConsensus Flowchart-tag-mr.svg English: CC Flowchart Date 25 March 2019 Source Own work Author Mamtapawar512...

Click to read more »
File:Fig 1. Phylogenetic relationships within subtribe Angraecinae.png
Selasa, 2025-10-21 13:27:05

Creative Commons Attribution 4.0 truetrue English 50% Bayesian majority-rule consensus tree from combined plastid data (matK, rps16 and trnL). determination...

Click to read more »
File:United Kingdom labelled map7.png
Selasa, 2020-09-08 10:21:34

version as of 02:16, 17 July 2008- colors as used were agreed upon by consensus, and green is clearly too political to stay) 16:35, 1 December 2008 Roadnote...

Click to read more »
File:Proof of Kernel Work - a democratic low-energy consensus for distributed access-control protocols.pdf
Minggu, 2025-04-20 02:09:56

DescriptionProof of Kernel Work - a democratic low-energy consensus for distributed access-control protocols.pdf English: Lundbæk, Leif-Nissen; Janes...

Click to read more »
File:C4D-Rome Consensus.pdf
Jumat, 2024-01-12 13:33:44

DescriptionC4D-Rome Consensus.pdf English: How to empower NGOs and local populations to report efficiently about implementation of development aid project...

Click to read more »
File:REACHING A CONSENSUS TO UPDATE OSHA'S PERMISSIBLE EXPOSURE LEVELS (IA gov.gpo.fdsys.CHRG-107hhrg82140).pdf
Selasa, 2024-08-20 19:17:19

REACHING A CONSENSUS TO UPDATE OSHA'S PERMISSIBLE EXPOSURE LEVELS   (  ) Author Committee on Education and the Workforce Title REACHING A CONSENSUS TO UPDATE...

Click to read more »
File:Rob Uncles (2008).png
Selasa, 2023-10-03 20:45:34

"YOU", Berlin author name string: VarsityConsensus Wikimedia username: VarsityConsensus URL: https://commons.wikimedia.org/wiki/User:VarsityConsensus...

Click to read more »
File:Shared Stewardship (20161004-FS-ElDorado-001).jpg
Kamis, 2026-05-07 15:10:00

4 March 2026 English The Amador-Calaveras Consensus Group Cornerstone Project in the Eldorado and Stanislaus National Forests, California. Photo from...

Click to read more »
File:EXAMINING THE USE OF NON-CONSENSUS STANDARDS IN WORKPLACE HEALTH AND SAFETY (IA gov.gpo.fdsys.CHRG-109hhrg27980).pdf
Kamis, 2026-05-28 23:20:37

NON-CONSENSUS STANDARDS IN WORKPLACE HEALTH AND SAFETY   (  ) Author Committee on Education and the Workforce Title EXAMINING THE USE OF NON-CONSENSUS STANDARDS...

Click to read more »
File:CHL orthographic.svg
Kamis, 2026-03-19 23:05:01

the Spanish Wikipedia style conventions. Please do not edit unless a consensus has been reached on the Spanish Wikipedia. If the conventions of other...

Click to read more »
File:Map of Appalachia without county borders.svg
Selasa, 2026-02-10 03:38:20

Sources: ARC counties: https://www.arc.gov/about-the-appalachian-region/ "Consensus Appalachia" by John Alexander Williams: https://geography.vt...

Click to read more »
File:सर्वसहमतीची निर्णय - प्रक्रिया.pdf
Sabtu, 2025-11-29 21:54:15

https://creativecommons.org/licenses/by-sa/4.0CC BY-SA 4.0 Creative Commons Attribution-Share Alike 4.0 truetrue English Consensus decision making process...

Click to read more »
File:Beyond the Washington Consensus Promoting Economic Growth and Minimizing the Threat of Violence in Latin America through Social Development (IA beyondwashington109456770).pdf
Sabtu, 2024-08-24 23:51:03

Beyond the Washington Consensus Promoting Economic Growth and Minimizing the Threat of Violence in Latin America through Social Development   (  ) Author...

Click to read more »
File:Partnering, consensus building, and alternative dispute resolution- Current uses and opportunities in the U.S. Army Corps of Engineers - USACE-p16021coll2-3894.pdf
Minggu, 2026-01-04 22:19:46

English: Partnering, consensus building, and alternative dispute resolution: Current uses and opportunities in the U.S. Army Corps of Engineers   (  )...

Click to read more »
File:Nye Oakley (2008).png
Senin, 2024-06-03 16:18:14

"YOU", Berlin author name string: VarsityConsensus Wikimedia username: VarsityConsensus URL: https://commons.wikimedia.org/wiki/User:VarsityConsensus...

Click to read more »
File:Viruses-11-00298-g002.webp
Rabu, 2024-10-09 17:39:42

BY 4.0 Creative Commons Attribution 4.0 truetrue English Overview of consensus structures of RNA secondary structure used for the annotation of flavivirus...

Click to read more »
File:Water-13-02057-g004-Oxyrrhis-5.svg
Selasa, 2026-05-05 09:36:03

org/licenses/by/4.0CC BY 4.0 Creative Commons Attribution 4.0 truetrue English Consensus Maximum likelihood tree of nuclear small subunit (SSU) sequences for 6...

Click to read more »
File:Peaceful consensus- How China's changing governance structure has affected its use of military force (IA peacefulconsensu1094555629).pdf
Rabu, 2024-08-28 15:53:49

Peaceful consensus: How China's changing governance structure has affected its use of military force   (  ) Author Jin, Sean J. Title Peaceful consensus: How...

Click to read more »
File:Europe islands.svg
Rabu, 2020-10-21 20:55:12

of 07:04, 11 April 2011; ; do not upload over existing version without consensus. 2011-11-28T05:28:04Z Geogen 700x545 (211693 Bytes) 2011-11-28T04:28:01Z...

Click to read more »
File:Consensus Conference of Health Status Gaps of Low Income and Minority Populations - A Synopsis (IA consensusconfere00heal).pdf
Minggu, 2024-08-18 03:47:59

Consensus Conference of Health Status Gaps of Low Income and Minority Populations : A Synopsis   (  ) Author Health Resources and Services Administration...

Click to read more »
File:Sauropodomorpha tree Chapelle 2019.jpg
Rabu, 2026-03-11 11:10:16

org/licenses/by/4.0CC BY 4.0 Creative Commons Attribution 4.0 truetrue English Strict consensus tree of Sauropodomorpha Russian Дерево строгого консенсуса завроподоморфов...

Click to read more »
File:Science Advice to NASA- Conflict, Consensus, Partnership, Leadership - NASA Monographs in Aerospace History, No. 57 (2017).pdf
Sabtu, 2024-08-17 19:13:17

DescriptionScience Advice to NASA- Conflict, Consensus, Partnership, Leadership - NASA Monographs in Aerospace History, No. 57 (2017).pdf Joseph K. Alexander...

Click to read more »
File:1r4o.png
Minggu, 2024-04-21 03:34:53

in adjacent major grooves. In one complex, the DNA has the symmetrical consensus target sequence; in the second, the central spacing between the target's...

Click to read more »
File:Conflict or consensus- East Germany, the Soviet Union and Deutschlandpolitik 1958-1984. (IA conflictorconsen00petz).pdf
Minggu, 2024-08-18 03:17:34

Conflict or consensus: East Germany, the Soviet Union and Deutschlandpolitik 1958-1984.   (  ) Author Petzold, Thomas M. Title Conflict or consensus: East Germany...

Click to read more »
File:Texas Childrens Hospital Houston at Night.jpg
Sabtu, 2026-02-28 07:24:42

(1413052 bytes) Reverted to version as of 00:58, 21 February 2010 per consensus 2010-02-22 01:27 Nsaum75 1571×1130 (1466727 bytes) Reprocessed x2 2010-02-22...

Click to read more »
File:SOLAR ENERGY DEVELOPMENT ON FEDERAL LANDS- THE ROAD TO CONSENSUS (IA gov.gpo.fdsys.CHRG-111hhrg49683).pdf
Minggu, 2024-08-25 02:05:57

THE ROAD TO CONSENSUS   (  ) Author Committee on Natural Resources Title SOLAR ENERGY DEVELOPMENT ON FEDERAL LANDS: THE ROAD TO CONSENSUS Publisher Government...

Click to read more »
File:Classes of ERVs.svg
Selasa, 2024-03-19 12:58:47

dendrogram. Unrooted Pol neighbor joining (NJ) dendrogram (500 bootstraps consensus) of the seven retroviral genera: alpha-, beta-, gamma-, delta-, Uploaded...

Click to read more »
File:Westwood - Letter from Lord Farrer 1930.jpg
Jumat, 2020-09-25 07:36:58

Mark 1.0falsefalse What is the status of this image. There seems to be a consensus on the village pump that it is legal to use Alvanhholmes (talk) 21:30...

Click to read more »
File:Jerome Simeon (2008).png
Jumat, 2024-07-05 03:16:26

name string: VarsityConsensus Wikimedia username: VarsityConsensus URL: https://commons.wikimedia.org/wiki/User:VarsityConsensus determination method...

Click to read more »
File:Dax O'Callaghan (2008).png
Minggu, 2024-06-23 11:49:15

name string: VarsityConsensus Wikimedia username: VarsityConsensus URL: https://commons.wikimedia.org/wiki/User:VarsityConsensus determination method...

Click to read more »
File:A bill to establish the Medicare Eligible Military Retiree Health Care Consensus Task Force (IA billtoestablishm00unit).pdf
Minggu, 2024-08-18 13:20:50

bill to establish the Medicare Eligible Military Retiree Health Care Consensus Task Force   (  ) Author United States. Congress. House United States...

Click to read more »
File:Water-13-02057-g004.webp
Kamis, 2025-01-23 16:31:17

org/licenses/by/4.0CC BY 4.0 Creative Commons Attribution 4.0 truetrue English Consensus Maximum likelihood tree of nuclear small subunit (SSU) sequences for 6...

Click to read more »
File:89-634-EEC- Council Decision of 6 November 1989 on the conclusion of an arrangement and a consensus with the United States of America concerning trade in certain steel products (EUD 1989-634).pdf
Senin, 2023-06-05 20:51:16

Decision of 6 November 1989 on the conclusion of an arrangement and a consensus with the United States of America concerning trade in certain steel products...

Click to read more »
File:Consensus new and old.svg
Jumat, 2024-04-12 08:39:36

DescriptionConsensus new and old.svg English: See w:Wikipedia_talk:Consensus Date 29 January 2007 (original upload date) Source Based on Image:Consensus plain...

Click to read more »
File:Konsensusdiagram (bokmål).svg
Jumat, 2026-05-29 20:44:01

Creative Commons Attribution-Share Alike 4.0 truetrue English Norwegian Bokmål translation of a consensus flowchart determination method or standard: SHA-1...

Click to read more »
File:89-636-ECSC- Commission Decision of 11 December 1989 on the conclusion of an arrangement and a consensus with the United States of America concerning trade in certain steel products (EUD 1989-636).pdf
Jumat, 2025-08-01 10:30:30

Decision of 11 December 1989 on the conclusion of an arrangement and a consensus with the United States of America concerning trade in certain steel products...

Click to read more »
File:Rabies Free Countries Sourced 2010.svg
Kamis, 2025-04-10 09:53:26

territories are free from urban and sylvatic rabies by international consensus. Bat rabies occurs in all countries except for Australia and New Zealand...

Click to read more »
File:Water-13-02057-g005.webp
Kamis, 2025-01-23 16:36:47

org/licenses/by/4.0CC BY 4.0 Creative Commons Attribution 4.0 truetrue English Consensus Maximum likelihood tree of nuclear internal transcribed spacer 1 (ITS1)-5...

Click to read more »
File:ADDRESSING CONCERNS ABOUT THE U.S. DEPARTMENT OF LABOR'S USE OF NON-CONSENSUS STANDARDS IN WORKPLACE HEALTH AND SAFETY (IA gov.gpo.fdsys.CHRG-109hhrg28432).pdf
Rabu, 2024-08-21 05:18:33

ADDRESSING CONCERNS ABOUT THE U.S. DEPARTMENT OF LABOR'S USE OF NON-CONSENSUS STANDARDS IN WORKPLACE HEALTH AND SAFETY   (  ) Author Committee on Education...

Click to read more »
File:Helicobacter pylori2.jpg
Sabtu, 2024-08-17 21:43:10

pylori.jpg]] - ''[[Helicobacter pylori]]'' bacteria, from the NIH (http://consensus.nih.gov/cons/094/094_intro.htm) and hence in the public domain. [[Category:Bacterial...

Click to read more »
File:Early chondrichthyan oral structure distribution.jpg
Rabu, 2025-09-10 22:20:27

of early chondrichthyans and distribution of oral structures. Strict consensus of 26,101 most parsimonious trees on left and Bayesian analysis on right...

Click to read more »
File:Cook 2013 97 percent.jpg
Selasa, 2025-05-13 07:08:06

taken from Cook et al., 2013, which shows the famous >97% w:scientific consensus on climate change, and that it had been steady for a very long time. This...

Click to read more »
File:A bill to establish the Medicare Eligible Military Retiree Health Care Consensus Task Force (IA billtoestablishm00unit 3).pdf
Rabu, 2024-08-28 03:09:54

bill to establish the Medicare Eligible Military Retiree Health Care Consensus Task Force   (  ) Author United States. Congress. House United States...

Click to read more »
File:Community process and admin discretion interplay.png
Senin, 2024-04-08 12:21:11

Attribution-Share Alike 4.0 truetrue English Proposed interplay between community consensus processes and individual admin discretionary actions author name string:...

Click to read more »
File:Cladogram Langbergia.jpg
Kamis, 2024-08-22 03:54:37

Attribution-Share Alike 4.0 truetrue English Figure 13 Majority-rule consensus tree of the analysis with characters having equal weights plotted against...

Click to read more »
File:Greek national security concerns and the European Union's common security and defense policy Consensus or divergence? (IA greeknationalsec109455515).pdf
Minggu, 2024-08-18 21:14:24

concerns and the European Union's common security and defense policy Consensus or divergence?   (  ) Author Menychtas, Charalampos Title Greek national...

Click to read more »
File:Consensus flow chart.svg
Minggu, 2025-04-13 01:04:09

DescriptionConsensus flow chart.svg English: Flowchart of consensus based decision-making Français : Diagramme représentant un mode de prise de décision...

Click to read more »
File:Handelszahlen DE mit Europa.png
Rabu, 2024-09-11 00:29:26

recognise. 2008-03-11T18:16:39Z Avala 2079x1269 (108355 Bytes) there is no consensus in Europe 2008-02-24T02:42:36Z Hoshie 2079x1269 (108435 Bytes) Added Kosovo...

Click to read more »
File:Consensus-flowchart.png
Jumat, 2024-04-12 08:38:44

DescriptionConsensus-flowchart.png English: Flowchart of consensus based decision-making Français : Diagramme représentant un mode de prise de décision...

Click to read more »
File:Northwest Teritories Legislative Assembly - Seating Chart.svg
Kamis, 2024-10-24 10:56:36

plan of the Legislative Assembly of Northwest Territories. NWT uses a consensus-style government, and there are no political parties at a territorial...

Click to read more »
File:CORRUPTION IN THE UNITED NATIONS OIL-FOR-FOOD PROGRAM- REACHING A CONSENSUS ON UNITED NATIONS REFORM (IA gov.gpo.fdsys.CHRG-109shrg24445).pdf
Rabu, 2024-08-21 05:43:05

CORRUPTION IN THE UNITED NATIONS OIL-FOR-FOOD PROGRAM: REACHING A CONSENSUS ON UNITED NATIONS REFORM   (  ) Author Committee on Homeland Security and...

Click to read more »
File:Processo de consenso.png
Rabu, 2024-01-10 00:01:50

choice. This image is a derivative work of the following images: File:Consensus_Flowchart.svg licensed with Cc-by-sa-3.0, GFDL 2010-04-05T19:50:26Z File...

Click to read more »
File:CrowCommons.png
Sabtu, 2025-12-20 02:14:32

Commons Attribution-Share Alike 4.0 truetrue English Jason Appleton during Consensus 2018 Wikimedia username: OneManPOP author name string: OneManPOP URL:...

Click to read more »
File:Medieval Multiculturalism.jpg
Kamis, 2026-04-02 23:31:44

destruction snd White washing. Now re-examine Europe's history without the Consensus explinations. Without the mainstream racially bias distortion. Just research...

Click to read more »
File:Dialectes de la Moselle ( version corrigée).svg
Minggu, 2026-04-26 19:24:55

4.0 truetrue English French Suppression du mot "éteint" dans la légende suite à consensus après discussion . determination method or standard: SHA-1...

Click to read more »
File:Diagramma consenso.svg
Minggu, 2026-04-26 18:52:41

choice. This image is a derivative work of the following images: File:Consensus Flowchart.svg licensed with Cc-by-sa-3.0, GFDL 2010-04-05T19:50:26Z File...

Click to read more »
File:Women's assembly near Qamislo.jpg
Minggu, 2025-06-08 15:44:32

January 2021 English Women's assembly meeting near Qamishli based off consensus democracy Flickr user ID: 36267050@N04 author name string: Janet Biehl...

Click to read more »
File:Consensus traduit.jpg
Jumat, 2024-04-12 08:39:49

DescriptionConsensus traduit.jpg Français : Traduction de l'arbre décisionnel anglais Date 23 April 2012 Source Own work This file was derived from: Consensus-flowchart...

Click to read more »
File:Wrong fraction.png
Minggu, 2025-11-16 23:42:56

Fraction of nodes with the incorrect bit in the three state protocol for consensus, for n=500 nodes, where initially 1/4 of the nodes hold the wrong bit...

Click to read more »
File:Consensus Flowchart ja.svg
Jumat, 2024-04-12 08:39:10

DescriptionConsensus Flowchart ja.svg English: Consensus Flowchart with Japanese text Date 20 February 2010 Source en:File:Consensus Flowchart.svg (chart)...

Click to read more »
File:Example of a well-aimed snowball on an English Wikipedia discussion.png
Jumat, 2025-05-23 12:59:53

Attribution-Share Alike 4.0 truetrue English An example discussion with strong consensus towards implementing a change with no policy backing. author name string:...

Click to read more »
File:Consensus Flowchart.png
Jumat, 2024-04-12 08:39:06

DescriptionConsensus Flowchart.png 日本語: 合意形成のja:フローチャート Date 15 June 2009 Source ja:en:File:Consensus Flowchart.svgを参考として自作 Author Sweeper tamonten Other...

Click to read more »
File:Wikipedia-logo-v2-th (2010-08-17 Ver.).svg
Minggu, 2024-10-27 19:38:18

English Wikipedia logo 2.0 (th) with font design by Thai Wikipedia's consensus. TH Sarabun PSK is a free font from SIPA. Uploaded for the sake of discussions...

Click to read more »
File:Diagrama de flujo Consenso.svg
Kamis, 2026-01-22 17:48:58

choice. This image is a derivative work of the following images: File:Consensus_Flowchart.svg licensed with Cc-by-sa-3.0, GFDL 2010-04-05T19:50:26Z File...

Click to read more »
File:Consensus Cards.svg
Jumat, 2024-04-12 08:38:53

DescriptionConsensus Cards.svg English: Front face, back face and embossing mask for credit-card sized consensus cards. Inspired by the description availabile...

Click to read more »
File:PGDX Manila 2024 Indie Game Stars 40.jpg
Minggu, 2026-01-18 06:00:56

PGDX Manila 2024 Indie Game Stars - MatchUp Championship! by Mapua Game Consensus: Team Supernovae author name string: BiancaBrazal Wikimedia username:...

Click to read more »
File:Letter regarding letter dated July 3, 2019, transmitting the Missouri River Recovery Implementation Committee's (MRRIC) consensus recommendations to the U.S. Army Corps of Engineers (USACE) conc ... - USACE-p16021coll7-12649.pdf
Kamis, 2025-04-03 14:50:08

transmitting the Missouri River Recovery Implementation Committee's (MRRIC) consensus recommendations to the U.S. Army Corps of Engineers (USACE) concerning...

Click to read more »
File:Consensus Flow.png
Rabu, 2025-04-16 09:05:50

DescriptionConsensus Flow.png English: for discussion only Date 16:08, 20 November 2011 (UTC) Source I (Uniplex (talk)) created this work entirely by...

Click to read more »
File:2009-08-26-Travis Kriplean - Wikimania 2009 - tools for scaling consensus.ogv
Sabtu, 2023-04-15 07:40:36

Description2009-08-26-Travis Kriplean - Wikimania 2009 - tools for scaling consensus.ogv English: Presentation for Wikimania 2009: Tools for Supporting Deliberation...

Click to read more »
File:EU and TRNC.png
Sabtu, 2026-04-04 12:22:29

recognise. 2008-03-11T18:16:39Z Avala 2079x1269 (108355 Bytes) there is no consensus in Europe 2008-02-24T02:42:36Z Hoshie 2079x1269 (108435 Bytes) Added Kosovo...

Click to read more »
File:CCFD Engine 14 Responding to Valley HS Fire Alarm.jpg
Minggu, 2025-03-16 22:10:01

to a fire alarm at Valley High School on March 11th, 2022. The general consensus among students was that a student pulled the fire alarm to avoid an assembly...

Click to read more »
File:Consensus icon.svg
Jumat, 2026-05-22 11:13:10

DescriptionConsensus icon.svg My "consensus" icon. Date 25 May 2008 Source Own work based on: Crystal Clear app kdmconfig.svg and CrystalClearActionApply...

Click to read more »
File:Hallin's spheres.svg
Sabtu, 2025-12-27 11:51:54

Attribution-Share Alike 4.0 truetrue English [[en:Hallin's spheres]]: Sphere of consensus, sphere of controversy, sphere of deviance Wikimedia username: Tenbergen...

Click to read more »
File:Cost of electricity by source.png
Kamis, 2026-01-08 18:59:14

3.0 Creative Commons Attribution-Share Alike 3.0 truetrue English The consensus of recent (2020) major global analysis of generation costs is that wind...

Click to read more »
File:CiudadesPBA.jpg
Senin, 2024-03-18 17:31:54

correction using that drawing tool. If you want to make a change, please get consensus in the discussion tab before ask it. In both cases, please do not generate...

Click to read more »
File:WikiConference North America 2018 - Friday Group Photo.jpg
Sabtu, 2026-02-28 07:07:37

This is the consensus-decided better photograph of the Friday group photograph. This is out of about 90 photos taken by the 3 photographers. I, the copyright...

Click to read more »
File:BlankMap-Europe-v5a.png
Minggu, 2023-11-26 23:46:14

recognise. 2008-03-11T18:16:39Z Avala 2079x1269 (108355 Bytes) there is no consensus in Europe 2008-02-24T02:42:36Z Hoshie 2079x1269 (108435 Bytes) Added Kosovo...

Click to read more »
File:Consensus flowchart 2.svg
Jumat, 2024-04-12 08:39:23

DescriptionConsensus flowchart 2.svg English: Based on Date 10 February 2017 Source Own work Author Atón...

Click to read more »
File:Consensus Flowchart-ml.svg
Jumat, 2024-04-12 08:39:02

DescriptionConsensus Flowchart-ml.svg English: Based upon File:CCC Flowchart 6.jpg created by Kevin Murray. Date 13 March 2019 Source File:Consensus Flowchart...

Click to read more »
File:B35 annotated alignment structure conservation.svg
Minggu, 2023-10-08 17:13:58

, Andreas R Gruber and Peter F Stadler (2008). "RNAalifold: improved consensus structure prediction for RNA alignments". BMC Bioinformatics 9 (474)....

Click to read more »
File:Northwest Crown Fire Experiment.png
Senin, 2026-06-01 23:48:36

the other file. Please note that deleting superseded images requires consensus. Reason to use the other file: "A JPG version of this file is now available...

Click to read more »
File:Functional Consensus Flowchart.jpg
Senin, 2025-11-10 10:47:44

DescriptionFunctional Consensus Flowchart.jpg English: A flowchart that depicts consensus decision making with built-in designs to increase the efficiency of consensus. Date...

Click to read more »
File:Consensus Flowchart-gu.svg
Jumat, 2024-04-12 08:39:00

DescriptionConsensus Flowchart-gu.svg ગુજરાતી: જ્યારે સંપાદન કરવામાં આવે છે, ત્યારે અન્ય સંપાદકો પાસે આ વિકલ્પો હોય છે: સંપાદન સ્વીકારો, સંપાદન બદલો અથવા...

Click to read more »
File:Islam in Europe.png
Selasa, 2023-12-05 04:05:02

recognise. 2008-03-11T18:16:39Z Avala 2079x1269 (108355 Bytes) there is no consensus in Europe 2008-02-24T02:42:36Z Hoshie 2079x1269 (108435 Bytes) Added Kosovo...

Click to read more »
File:Carcharodon carcharias range.svg
Rabu, 2025-11-12 18:14:54

Global range of the great white shark (Carcharodon carcharias) based on a consensus by 43 international experts author name string: Macrophyseter Wikimedia...

Click to read more »
File:Consensus-flowchart-укр.png
Jumat, 2024-04-12 08:38:43

DescriptionConsensus-flowchart-укр.png Українська: Блок-схема прийняття рішень в процесі пошуку консенсусу Date 12/5/2008 Source Базувався на англійській...

Click to read more »
File:Consensus among three Wikipedians.svg
Rabu, 2026-05-20 04:49:55

DescriptionConsensus among three Wikipedians.svg English: A diagram depicting consensus among three Wikipedians, created from video stills from Category:Fundraising...

Click to read more »
File:Human Skin Colour Distribution 26,000 BC - 1500 AD.gif
Jumat, 2026-01-23 22:44:36

from the Last Glacial Maximum to the early modern era based on the scientific consensus at the time of creation. determination method or standard: SHA-1...

Click to read more »
File:National Agricultural Library 50 year anniversary edit-o-thon September 20 2019 010.jpg
Selasa, 2025-06-17 11:30:27

Consensus-chosen photograph by Gerald Shields I, the copyright holder of this work, hereby publish it under the following license: This file is licensed...

Click to read more »
File:Consensus Flowchart-te.svg
Jumat, 2024-04-12 08:39:05

DescriptionConsensus Flowchart-te.svg English: Based upon CCC Flowchart 6.jpg created by Kevin Murray. Date 10 March 2019 Source Transferred from en.wikipedia...

Click to read more »
File:Consensus Flowchart-ky.svg
Selasa, 2025-12-16 22:17:37

DescriptionConsensus Flowchart-ky.svg English: Based upon Consensus Flowchart.svg. Text translated to Kyrgyz by Incall. The text has not been converted...

Click to read more »
File:YES to Fair Use-2.svg
Minggu, 2023-02-12 05:31:23

Cc-by-2.5 2011-08-06T11:52:46Z Postoronniy-13 100x100 (5654 Bytes) non-consensus edit reverted 2011-08-05T20:46:09Z MaxBioHazard 100x100 (4929 Bytes) Removed...

Click to read more »
File:Letter regarding letter dated July 3, 2019, transmitting the Missouri River Recovery Implementation Committee's (MRRIC) consensus recommendations for the U.S. Army Corps of Engineers (USACE) and the ... - USACE-p16021coll7-12650.pdf
Jumat, 2025-12-05 02:56:27

transmitting the Missouri River Recovery Implementation Committee's (MRRIC) consensus recommendations for the U.S. Army Corps of Engineers (USACE) and the U...

Click to read more »
File:Obelisk of Iguazú (Misiones, Argentina).jpg
Senin, 2026-02-16 20:14:18

pump/Copyright/Archive/2012/12#Category:Obelisk of Buenos Aires for the consensus to keep images of this monument despite the lack of freedom of panorama...

Click to read more »
File:National Agricultural Library 50 year anniversary edit-o-thon September 20 2019 002.jpg
Sabtu, 2024-11-30 15:30:07

Consensus-chosen photograph by Gerald Shields I, the copyright holder of this work, hereby publish it under the following license: This file is licensed...

Click to read more »
File:National Agricultural Library 50 year anniversary edit-o-thon September 20 2019 006.jpg
Senin, 2022-11-28 06:26:57

Consensus-chosen photograph by Gerald Shields I, the copyright holder of this work, hereby publish it under the following license: This file is licensed...

Click to read more »
File:Cook et al. (2016) Studies consensus-en.svg
Sabtu, 2026-01-03 20:06:44

Stuart Carlton, and John Cook. See John Cook u. a. Consensus on consensus: a synthesis of consensus estimates on human-caused global warming. Environmental...

Click to read more »
File:Ficus sur distribution.png
Minggu, 2025-09-14 03:04:03

is the last consensus version: it had incremental improvements from the version "Dim Grits" arbitrarily perceived as the last consensus (17 Sep 2018)...

Click to read more »
File:Consensus intron.jpg
Jumat, 2024-04-12 08:39:26

DescriptionConsensus intron.jpg English: Intron showing consensus sequences. Date 28 April 2009 Source Own work Author Agathman...

Click to read more »
File:Consensus Flowchart-pa.svg
Minggu, 2024-12-01 18:16:25

DescriptionConsensus Flowchart-pa.svg ਪੰਜਾਬੀ: ਸਹਿਮਤੀ ਦਾ ਨਕਸ਼ਾ Date 20 March 2019 Source Author Translated into Punjabi by User:Nirmal Brar Faridkot Other...

Click to read more »
File:Letter regarding letter dated July 3, 2019, transmitting the Missouri River Recover Implementation Committee's (MRRIC) consensus recommendations for the U.S. Army Corps of Engineers (USACE) and ... - USACE-p16021coll7-19307.pdf
Sabtu, 2025-04-12 06:09:16

transmitting the Missouri River Recover Implementation Committee's (MRRIC) consensus recommendations for the U.S. Army Corps of Engineers (USACE) and the U...

Click to read more »
File:Covert-action-crypto-gameplay.png
Selasa, 2024-04-23 14:15:25

 Comment: the state is based on consensus of this discussion. I, the copyright holder of this work, hereby publish it under the following license: This...

Click to read more »
File:Letter regarding letter dated July 3, 2019, transmitting the Missouri River Recover Implementation Committee's (MRRIC) consensus recommendations for the U.S. Army Corps of Engineers (USACE) and ... - USACE-p16021coll7-17652.pdf
Minggu, 2025-04-13 16:45:30

transmitting the Missouri River Recover Implementation Committee's (MRRIC) consensus recommendations for the U.S. Army Corps of Engineers (USACE) and the U...

Click to read more »
File:Letter regarding email dated May 30, 2019 transmitting the Missouri River Recovery Implementation Committee's (MRRIC) consensus recommendations on effective Adaptive Management (AM) governance f ... - USACE-p16021coll7-12648.pdf
Sabtu, 2026-03-28 14:56:13

transmitting the Missouri River Recovery Implementation Committee's (MRRIC) consensus recommendations on effective Adaptive Management (AM) governance for the...

Click to read more »
File:The Special Consensus 2011.jpg
Sabtu, 2026-03-07 02:57:52

DescriptionThe Special Consensus 2011.jpg English: Special Consensus Date 27 January 2011, 00:12 Source https://www.flickr.com/photos/perrylane/5406304796/sizes/o/...

Click to read more »
File:Consensus Flowchart as.svg
Jumat, 2024-04-12 08:39:07

DescriptionConsensus Flowchart as.svg English: Consensus Flowchart Date ২০১৯-০৩-২৪ Source File:Consensus Flowchart.svg Author File:Consensus Flowchart...

Click to read more »
File:Openness and control.pdf
Kamis, 2026-04-16 11:23:53

could not be finished, because it was impossible to find a comprehensive consensus version of the Wikipedians’ views and demands. Lessons learned: ­ Planning...

Click to read more »
File:Consensus flowchart 2 el.svg
Jumat, 2024-04-12 08:39:24

DescriptionConsensus flowchart 2 el.svg English: Based on , translated in Greek Date 10 February 2017 Source File:Consensus_flowchart_2.svg Author Atón...

Click to read more »
File:Consensus Economics Logo.gif
Senin, 2017-02-13 09:24:29

organization by Wikipedia or the Wikimedia Foundation, nor vice versa. Fair use //en.wikipedia.org/wiki/File:Consensus_Economics_Logo.gif true Fair use true...

Click to read more »
File:Zach Witkoff at Consensus 2025.jpg
Kamis, 2026-05-07 06:48:13

DescriptionZach Witkoff at Consensus 2025.jpg English: Zach Witkoff at Consensus 2025 in Toronto (May 16, 2025) Date 17 May 2025, 01:58:34 Source Own...

Click to read more »
File:National Agricultural Library 50 year anniversary edit-o-thon September 20 2019 012 Group Photo.jpg
Sabtu, 2025-10-04 12:51:41

Consensus-chosen photograph by Gerald Shields I, the copyright holder of this work, hereby publish it under the following license: This file is licensed...

Click to read more »
File:Consensus Organigramme.svg
Jumat, 2024-04-12 08:39:16

DescriptionConsensus Organigramme.svg English: Flowchart representing the process to keep a consensus for a Wikipedia article change. Français : Diagramme...

Click to read more »
File:National Agricultural Library 50 year anniversary edit-o-thon September 20 2019 005.jpg
Senin, 2021-10-11 05:45:05

Consensus-chosen photograph by Gerald Shields I, the copyright holder of this work, hereby publish it under the following license: This file is licensed...

Click to read more »
File:Consensus kaz.svg
Jumat, 2024-04-12 08:39:28

DescriptionConsensus kaz.svg English: Consensus searching in Kazakh Date 31 January 2012 Source self-made based on Image:Consensus new and old russ.svg...

Click to read more »
File:National Agricultural Library 50 year anniversary edit-o-thon September 20 2019 008.jpg
Selasa, 2026-05-26 05:33:51

Consensus-chosen photograph by Gerald Shields I, the copyright holder of this work, hereby publish it under the following license: This file is licensed...

Click to read more »
File:Consensusdemocratie.png
Minggu, 2025-10-26 06:14:57

Commons Attribution-Share Alike 4.0 truetrue English Two approaches to consensus-building within systems of proportional representation: center-focused...

Click to read more »
File:Dhaka Political Parties National Consensus Commission Discussion 2025-07-07 (PID-0001058).jpg
Minggu, 2026-04-26 12:22:13

DescriptionDhaka Political Parties National Consensus Commission Discussion 2025-07-07 (PID-0001058).jpg বাংলা: জাতীয় ঐকমত্য কমিশনের সাথে আজ ঢাকায় ফরেন...

Click to read more »
File:Consensus Logo.png
Jumat, 2024-04-12 08:39:13

DescriptionConsensus Logo.png English: The logo for Consensus digital magazine, as seen on the social media accounts. Date 10 May 2021 Source Own work...

Click to read more »
File:Uniting for Consensus core.png
Rabu, 2024-09-18 17:17:55

DescriptionUniting for Consensus core.png English: "Uniting for Consensus" group of nations concerned with United Nations Security Council reform (basically...

Click to read more »
File:Consensus Tigurinus.jpg
Selasa, 2025-12-16 22:17:44

DescriptionConsensus Tigurinus.jpg English: Title page of Consensus Tigurinus Date 1551 Source http://www.e-rara.ch/gep_g/content/pageview/682263 Author...

Click to read more »
File:Consensus bg.PNG
Jumat, 2024-04-12 08:39:21

DescriptionConsensus bg.PNG English: Consensus searching in Bulgarian Български: Търсене на консенсус на български Date 5 August 2008 Source Own work...

Click to read more »
File:Zak Folkman at Consensus 2025.jpg
Kamis, 2026-05-07 06:47:54

DescriptionZak Folkman at Consensus 2025.jpg English: Zak Folkman at Consensus 2025 in Toronto (May 16, 2025) Date 17 May 2025, 01:58:34 Source Own work...

Click to read more »
File:National Agricultural Library 50 year anniversary edit-o-thon September 20 2019 003.jpg
Senin, 2021-10-11 05:44:54

Consensus-chosen photograph by Gerald Shields I, the copyright holder of this work, hereby publish it under the following license: This file is licensed...

Click to read more »
File:National Agricultural Library 50 year anniversary edit-o-thon September 20 2019 011.jpg
Senin, 2021-10-11 05:45:35

Consensus-chosen photograph by Gerald Shields I, the copyright holder of this work, hereby publish it under the following license: This file is licensed...

Click to read more »
File:The Consensus on Anthropogenic Global Warming, 2017.jpg
Jumat, 2026-03-20 13:14:28

DescriptionThe Consensus on Anthropogenic Global Warming, 2017.jpg English: A bar chart of the 15 peer-reviewed studies of the consensus on AGW. Date 28...

Click to read more »
File:Cost-of-storms-by-decade.gif
Senin, 2026-01-05 05:07:47

due to greater exposure such as building on the coast." The emerging consensus was that it should have been based on a logistic sigmoid fit because the...

Click to read more »
File:National Agricultural Library 50 year anniversary edit-o-thon September 20 2019 004.jpg
Senin, 2021-10-11 05:44:59

Consensus-chosen photograph by Gerald Shields I, the copyright holder of this work, hereby publish it under the following license: This file is licensed...

Click to read more »
File:National Agricultural Library 50 year anniversary edit-o-thon September 20 2019 009.jpg
Senin, 2021-10-11 05:45:26

Consensus-chosen photograph by Gerald Shields I, the copyright holder of this work, hereby publish it under the following license: This file is licensed...

Click to read more »
File:Consensus zombies.png
Jumat, 2024-04-12 08:39:52

DescriptionConsensus zombies.png English: This is a humorous image of consensus zombies. Date 24 January 2008, 22:35 (UTC) (Uploaded on Commons at 2012-01-12...

Click to read more »
File:Sl2lab06.jpg
Kamis, 2025-03-20 10:48:36

kept a list of possible future projects on his office chalkboard, and a consensus favorite emerged: rocket research. Krause approached the U.S. Army, which...

Click to read more »
File:Consensus Discussion Process Flow.png
Rabu, 2023-10-04 07:27:09

DescriptionConsensus Discussion Process Flow.png Quy trình thảo luận xây dựng đồng thuận tại Wikipedia tiếng Việt Date 23 November 2021 Source Own work...

Click to read more »
File:Consensus poll flowchart.svg
Jumat, 2024-04-12 08:39:45

DescriptionConsensus poll flowchart.svg English: A flow chart describing how a Consensus poll works. Source Own work Author Stephen Bain...

Click to read more »
File:National Citizen Party Submits Reform Opinions To National Consensus Commission 2025-03-23 (PID-0002824).jpg
Sabtu, 2026-05-30 16:10:12

DescriptionNational Citizen Party Submits Reform Opinions To National Consensus Commission 2025-03-23 (PID-0002824).jpg বাংলা: জাতীয় ঐকমত্য কমিশনের সহসভাপতি...

Click to read more »
File:National Agricultural Library 50 year anniversary edit-o-thon September 20 2019 001.jpg
Senin, 2021-10-11 05:47:20

Consensus-chosen photograph by Gerald Shields I, the copyright holder of this work, hereby publish it under the following license: This file is licensed...

Click to read more »
File:Consensus majoritarian 2.jpg
Jumat, 2014-05-23 22:04:21

Chart summarising the difference between consensus and majoritarian democracy as outlined by Lijphart. I, the copyright holder of this work, hereby publish...

Click to read more »
File:Consensus Flowchart zh-hans.svg
Jumat, 2024-04-12 08:39:11

DescriptionConsensus Flowchart zh-hans.svg English: Consensus Flowchart with Simplified Chinese text 中文(简体):​共识流程图简体中文版 Date 22 June 2011 Source File:Consensus_Flowchart...

Click to read more »
File:AISHE 2.0 - 30 criteria (Nederlands).svg
Minggu, 2023-11-12 19:38:31

van AISHE 2.0, dat de huidige en de gewenste situatie toont, zoals in consensus is vastgesteld tijdens een assessment author name string: KlaasVanGiersbergen...

Click to read more »
File:Albright Special.jpg
Minggu, 2023-07-30 02:39:06

Refer to this discussion in EN Wikipedia for additional information. The consensus there was that the tag end should exit the knot on the same side of the...

Click to read more »
File:Consensus Flowchart el.svg
Jumat, 2024-04-12 08:39:08

DescriptionConsensus Flowchart el.svg Ελληνικά: Ένα απλουστευμένο διάγραμμα του τρόπου με τον οποίο επιτυγχάνεται συναίνεση. Όταν γίνεται επεξεργασία...

Click to read more »
File:Consensus flowchart ja.jpg
Jumat, 2024-04-12 08:39:24

DescriptionConsensus flowchart ja.jpg a flowchart for Consensus on Japanese Wikipedia Date 21 March 2008 Source translated from wikipedia:Image:CCC Flowchart...

Click to read more »
File:Logo Copenhagen Consensus Center.png
Sabtu, 2024-05-18 18:33:34

Wikipedia or the Wikimedia Foundation, nor vice versa. Fair use //en.wikipedia.org/wiki/File:Logo_Copenhagen_Consensus_Center.png true Fair use true...

Click to read more »
File:Cook et al. (2016) Studies consensus-de.svg
Kamis, 2025-11-27 03:22:26

Stuart Carlton, and John Cook. See John Cook u. a. Consensus on consensus: a synthesis of consensus estimates on human-caused global warming. Environmental...

Click to read more »
File:Consensus majoritarian 1.jpg
Jumat, 2014-05-23 22:06:33

Chart summarising the difference between consensus and majoritarian democracy as outlined by Lijphart. I, the copyright holder of this work, hereby publish...

Click to read more »
File:Kit body engaway08a.png
Rabu, 2023-05-24 04:11:01

19:07 Grant.Alpaugh 38×59× (3011 bytes) removing logos per [[WT:FOOTY]] consensus 2008-06-25 22:22 PeeJay2K3 38×59× (3032 bytes) rm logos per discussion...

Click to read more »
File:Cook et al. (2016) Studies consensus-ar.svg
Kamis, 2025-11-27 03:22:26

DescriptionCook et al. (2016) Studies consensus-ar.svg العربية: نتائج دراسات متعددة حول التوافق العلمي في مسألة تسبب النشاط البشري في حصول الاحتباس الحراري...

Click to read more »
File:Consenso.svg
Jumat, 2024-04-12 08:38:35

Diagramma di flusso del consenso. |Fonte = Traduzione da [[:Commons:Image:Consensus new and old.svg]] |Data = 10 gennaio 2008 |Autore = Archenzo |Licenza...

Click to read more »
File:Consensus majoritarian 3.jpg
Jumat, 2014-05-23 22:08:50

Chart summarising the difference between consensus and majoritarian democracy as outlined by Lijphart. I, the copyright holder of this work, hereby publish...

Click to read more »
File:Consensus Diagnostic Criteria Raynauds.jpg
Jumat, 2024-04-12 08:38:57

DescriptionConsensus Diagnostic Criteria Raynauds.jpg English: Figure 2 from "International consensus criteria for the diagnosis of Raynaud's phenomenon"...

Click to read more »
File:Degrees of Consensus.jpg
Jumat, 2026-03-27 17:58:04

DescriptionDegrees of Consensus.jpg English: Degrees of consensus are labeled depending on their distance from facts. Date 5 January 2017, 03:45:04 Source...

Click to read more »
File:National Agricultural Library 50 year anniversary edit-o-thon September 20 2019 007.jpg
Senin, 2021-10-11 05:45:15

Consensus-chosen photograph by Gerald Shields I, the copyright holder of this work, hereby publish it under the following license: This file is licensed...

Click to read more »
File:Consensus of tow graph.jpg
Jumat, 2024-04-12 08:39:41

DescriptionConsensus of tow graph.jpg English: consensus of tow graph Date 13 June 2017 Source http://daneshnameh.roshd.ir/mavara Author http://daneshnameh...

Click to read more »
File:Consensus new and old russ.svg
Jumat, 2024-04-12 08:39:38

DescriptionConsensus new and old russ.svg Consensus searching in Russian Source self-made based on Image:Consensus new and old.svg Author EvgenyGenkin...

Click to read more »
File:Wiki consensus 002.svg
Selasa, 2026-03-31 13:33:15

DescriptionWiki consensus 002.svg 한국어: ko:위키백과:총의 형성 과정의 예시 Date 22 March 2010 Source 자작, 2차 저작물 Author SVG by Lambda Permission (Reusing this file) CC-BY-SA...

Click to read more »
File:MiR-10 consensus structure.svg
Selasa, 2022-09-20 20:19:05

DescriptionMiR-10 consensus structure.svg English: A consensus secondary structure for the microRNA miR-10. Date 2 October 2010, 20:27 (UTC) (2010-10-02...

Click to read more »
File:Toxicodryas blandingii distribution.png
Minggu, 2021-06-13 19:03:50

is the last consensus version: it had incremental improvements from the version "Dim Grits" arbitrarily perceived as the last consensus (17 Sep 2018)...

Click to read more »
File:What is Consensus Decision Making - Seeds For Change.webm
Senin, 2025-05-12 23:02:05

DescriptionWhat is Consensus Decision Making - Seeds For Change.webm English: This video, the first in a set of three, is an introduction to consensus decision...

Click to read more »
File:Consensus new and old-cs.svg
Jumat, 2024-04-12 08:39:31

DescriptionConsensus new and old-cs.svg English: Translated (Czech) version of Consensus new and old.svg Čeština: Český překlad Consensus new and old.svg...

Click to read more »
File:How to do consensus making - Seeds For Change.webm
Senin, 2025-05-12 07:35:01

DescriptionHow to do consensus making - Seeds For Change.webm English: This video, the second in a set of three, shows a suggested process for consensus decision...

Click to read more »
File:Conflict Engagement & Consensus Building In Organizations at WMCON 2018 13.jpg
Selasa, 2025-12-16 09:58:19

DescriptionConflict Engagement & Consensus Building In Organizations at WMCON 2018 13.jpg Deutsch: Workshop zum Thema Konflikte und Konsens English: Workshop...

Click to read more »
File:Us perceived consensus ru.jpg
Rabu, 2025-07-02 02:01:08

DescriptionUs perceived consensus ru.jpg Русский: Роль политических предпочтений в оценке определенности научных знаний о климате на примере США. По данным...

Click to read more »
File:No consensus.png
Jumat, 2025-07-11 01:29:19

DescriptionNo consensus.png English: How some AfD discussions come to no consensus. Date 14 September 2022 Source Own work Author Helloheart...

Click to read more »
File:Consensus nouveau et ancien.svg
Sabtu, 2024-08-31 22:20:03

DescriptionConsensus nouveau et ancien.svg Français : Traduction de consensus nouveau et ancien réalisé avec Inkscape Ayack Source Image:Consensus new and...

Click to read more »
File:Consensus poll flowchart.png
Jumat, 2024-04-12 08:39:44

File:Consensus poll flowchart.svg is a vector version of this file. It should be used in place of this PNG file when not inferior. File:Consensus poll...

Click to read more »
File:Bangladesh Nationalist Party Discussion National Consensus Commission Jatiya Sangsad Bhaban 2025-04-20 (PID-0002334).jpg
Jumat, 2026-05-08 15:43:09

DescriptionBangladesh Nationalist Party Discussion National Consensus Commission Jatiya Sangsad Bhaban 2025-04-20 (PID-0002334).jpg বাংলা: জাতীয় ঐকমত্য...

Click to read more »
File:Consensus Flowchart zh-hant.svg
Jumat, 2025-07-25 19:49:32

DescriptionConsensus Flowchart zh-hant.svg English: Consensus Flowchart with Traditional Chinese text 中文(繁體):​共識流程圖繁體中文版 Date 22 June 2011 Source File:Consensus_Flowchart...

Click to read more »
File:Consensus Flowchart ja.png
Jumat, 2024-04-12 08:39:09

DescriptionConsensus Flowchart ja.png English: Consensus Flowchart with Japanese text Date 20 February 2010 Source File:Consensus Flowchart ja.svg Author...

Click to read more »
File:Creation by evolution; a consensus of present-day knowledge as set forth by leading authorities in non-technical language that all may understand (IA creationbyevolut00maso).pdf
Rabu, 2025-07-02 07:11:38

Creation by evolution; a consensus of present-day knowledge as set forth by leading authorities in non-technical language that all may understand   (...

Click to read more »
File:Consensus 7.30.png
Rabu, 2024-09-11 14:49:43

DescriptionConsensus 7.30.png English: screenshot of my post Date 30 July 2021 Source Own work Author Peilin99...

Click to read more »
File:Consensus 2025 - Eric Trump 10 (3x4 cropped).jpg
Selasa, 2025-12-16 22:17:35

DescriptionConsensus 2025 - Eric Trump 10 (3x4 cropped).jpg English: Eric Trump at Consensus 2025 in Toronto (May 16, 2025) Date 17 May 2025, 01:42:28...

Click to read more »
File:Bayesian consensus phylogram for the Mustelidae.jpg
Senin, 2023-11-06 14:22:09

DescriptionBayesian consensus phylogram for the Mustelidae.jpg Français : Cladogramme des Mustélidés selon la publication suivante : Klaus-Peter Koepfli...

Click to read more »
File:COL orthographic.svg
Rabu, 2025-11-05 21:39:22

the Spanish Wikipedia style conventions. Please do not edit unless a consensus has been reached on the Spanish Wikipedia. If the conventions of other...

Click to read more »
File:Consensus new and old HY.svg
Jumat, 2024-04-12 08:39:37

DescriptionConsensus new and old HY.svg Հայերեն: Կոնսենսուսի հասնելու ճանապարհը Date 19 January 2015 Source Own work Author GeoO Other versions [edit]...

Click to read more »
File:Moravia in EU.png
Sabtu, 2025-05-10 16:56:30

0, GFDL 2009-10-23T00:31:25Z NuclearVacuum 2045x1720 (2732246 Bytes) consensus version 2009-10-18T16:53:46Z NuclearVacuum 2045x1720 (2743298 Bytes) final...

Click to read more »
File:Ford Fiesta 998cc registered June 2014 ie post 2013 facelift.JPG
Minggu, 2024-08-18 18:41:50

remains correct, however. Mark VI or Mark VII: There appears to be no wiki consensus over whether the 2013 facelift makes this a Fiesta Mark VI or a Fiesta...

Click to read more »
File:RF00182 consensus secondary structure.png
Selasa, 2026-05-26 21:22:44

DescriptionRF00182 consensus secondary structure.png English: Consensus RNA secondary structure of the Coronavirus packaging signal (Rfam family RF00182)...

Click to read more »
File:Alignment of human and consensus DUF3719.png
Jumat, 2026-05-29 11:24:38

DescriptionAlignment of human and consensus DUF3719.png English: This is an alignment of the domain of unknown function from human and the consensus sequence Date 15 May...

Click to read more »
File:Discussion consensus-cs.svg
Jumat, 2026-05-01 10:15:49

DescriptionDiscussion consensus-cs.svg Čeština: Vývojový diagram jak dojít ke konsensu na základě diskuse Date 4 February 2023 Source Own work Author...

Click to read more »
File:Consensus Flowchart.svg
Minggu, 2025-08-03 09:02:36

image or media file may be available on the Wikimedia Commons as File:Consensus Flowchart.svg, where categories and captions may be viewed. While the...

Click to read more »
File:Spigelia genuflexa strict consensus tree.jpg
Minggu, 2025-05-18 21:12:05

DescriptionSpigelia genuflexa strict consensus tree.jpg English: Strict consensus tree derived from molecular data (ITS and coded gaps) showing phylogenetic...

Click to read more »
File:Pt consensus.png
Rabu, 2023-03-01 02:25:58

DescriptionPt consensus.png English: A periodic table Date 16 May 2020 Source Own work Author Droog Andrey...

Click to read more »
File:20230529 Inconsistent simultaneous displays of same image in two articles.png
Senin, 2024-12-09 00:35:41

(talk) 18:57, 29 May 2023 (UTC) 20220629 Public estimates of scientific consensus on climate change - horizontal bar chart.svg 20220823 Public underestimation...

Click to read more »
File:EU-Portugal with islands circled.svg
Kamis, 2026-05-28 09:36:35

(Madeira) 2009-10-23T14:43:15Z NuclearVacuum 2045x1720 (2717843 Bytes) consensus version 2009-10-18T18:26:31Z NuclearVacuum 2045x1720 (2743299 Bytes) final...

Click to read more »
File:Bayesian consensus phylogram for the Mustelinae.jpg
Senin, 2023-11-06 14:22:10

DescriptionBayesian consensus phylogram for the Mustelinae.jpg Français : Cladogramme pour les Mustelinae. This file was derived from: Bayesian consensus phylogram...

Click to read more »
File:AUS orthographic.svg
Selasa, 2026-03-31 13:43:40

the Spanish Wikipedia style conventions. Please do not edit unless a consensus has been reached on the Spanish Wikipedia. If the conventions of other...

Click to read more »
File:Conflict Engagement & Consensus Building In Organizations at WMCON 2018 12.jpg
Selasa, 2025-12-16 09:58:18

DescriptionConflict Engagement & Consensus Building In Organizations at WMCON 2018 12.jpg Deutsch: Workshop zum Thema Konflikte und Konsens English: Workshop...

Click to read more »
File:Web-consensus-756.jpg
Kamis, 2012-03-22 06:51:17

SCM Canada members vote by consensus at National Council 2007 in Winnipeg. I, the copyright holder of this work, hereby release it into the public domain...

Click to read more »
File:Consensus.png
Jumat, 2024-04-12 08:38:47

DescriptionConsensus.png Français : Consensus Date 18 February 2006 (original upload date) Source Own work by the original uploader Author Dake...

Click to read more »
File:Conflict Engagement & Consensus Building In Organizations at WMCON 2018 06.jpg
Selasa, 2024-09-17 13:39:44

DescriptionConflict Engagement & Consensus Building In Organizations at WMCON 2018 06.jpg Deutsch: Workshop zum Thema Konflikte und Konsens English: Workshop...

Click to read more »
File:Countries by most used web browser.png
Senin, 2024-04-22 12:53:03

Bytes) Reverted to version as of 18:25, 11 March 2008 - international consensus should be present - Kosovo independent map should be variant 2008-03-13T16:40:34Z...

Click to read more »
File:EU-Portugal olivenza neutral.svg
Senin, 2026-03-23 12:29:53

(Madeira) 2009-10-23T14:43:15Z NuclearVacuum 2045x1720 (2717843 Bytes) consensus version 2009-10-18T18:26:31Z NuclearVacuum 2045x1720 (2743299 Bytes) final...

Click to read more »
File:Calling for consensus demonstration in front of Beit HaNassi 03.jpg
Sabtu, 2023-11-18 18:41:48

DescriptionCalling for consensus demonstration in front of Beit HaNassi 03.jpg English: calling for consensus demonstration in front of Beit HaNassi. Strengthen...

Click to read more »
File:Conflict Engagement & Consensus Building In Organizations at WMCON 2018 23.jpg
Selasa, 2025-12-16 09:58:23

DescriptionConflict Engagement & Consensus Building In Organizations at WMCON 2018 23.jpg Deutsch: Workshop zum Thema Konflikte und Konsens English: Workshop...

Click to read more »
File:Conflict Engagement & Consensus Building In Organizations at WMCON 2018 02.jpg
Selasa, 2025-12-16 09:58:10

DescriptionConflict Engagement & Consensus Building In Organizations at WMCON 2018 02.jpg Deutsch: Workshop zum Thema Konflikte und Konsens English: Workshop...

Click to read more »
File:Norhern Cyprus (orthographic projection).png
Minggu, 2026-01-11 20:43:20

0, GFDL 2009-10-23T14:59:50Z NuclearVacuum 2045x1720 (2721665 Bytes) consensus version 2009-10-18T19:01:04Z NuclearVacuum 2045x1720 (2746607 Bytes) minor...

Click to read more »
File:Conflict Engagement & Consensus Building In Organizations at WMCON 2018 27.jpg
Selasa, 2025-12-16 09:58:28

DescriptionConflict Engagement & Consensus Building In Organizations at WMCON 2018 27.jpg Deutsch: Workshop zum Thema Konflikte und Konsens English: Workshop...

Click to read more »
File:Consensus.jpg
Rabu, 2025-08-06 17:24:02

DescriptionConsensus.jpg English: Memorial Plate about the Plebiscite held, if or not to incorporate the Province of Treviso into the Kingdom of Italy...

Click to read more »
File:WMF-5000.png
Jumat, 2025-06-13 23:04:59

The following is a message composed via consensus of the Wikimedia Foundation Board of Trustees. For those who are not currently aware of our existence...

Click to read more »
File:How to make consensus genuinely democratic - Seeds For Change.webm
Senin, 2025-05-12 00:06:19

DescriptionHow to make consensus genuinely democratic - Seeds For Change.webm English: This video, the third in a set of three, looks at the attitudes...

Click to read more »
File:Consensus Diagnostic Criteria Raynaud's Phenomenon.pdf
Jumat, 2024-04-12 08:38:56

DescriptionConsensus Diagnostic Criteria Raynaud's Phenomenon.pdf English: Consensus Diagnostic Criteria Raynaud's Phenomenon Date 20 October 2014, 15:03:22...

Click to read more »
File:Consensus 2026 - Tom Lee 04 (cropped).jpg
Minggu, 2026-05-24 11:43:52

DescriptionConsensus 2026 - Tom Lee 04 (cropped).jpg English: Tom Lee speaking at Consensus Hong Kong 2026 Date 10 February 2026, 22:21:42 Source Own work...

Click to read more »
File:LL-Q150 (fra)-LoquaxFR-consensus mou.wav
Minggu, 2024-07-28 18:44:20

(fra)-LoquaxFR-consensus mou.wav Audio pronunciation file from the Lingua Libre project. Language InfoField French Transcription InfoField consensus mou Date...

Click to read more »
File:Conflict Engagement & Consensus Building In Organizations at WMCON 2018 11.jpg
Selasa, 2025-12-16 09:58:17

DescriptionConflict Engagement & Consensus Building In Organizations at WMCON 2018 11.jpg Deutsch: Workshop zum Thema Konflikte und Konsens English: Workshop...

Click to read more »
File:Conflict Engagement & Consensus Building In Organizations at WMCON 2018 20.jpg
Selasa, 2025-12-16 09:58:22

DescriptionConflict Engagement & Consensus Building In Organizations at WMCON 2018 20.jpg Deutsch: Workshop zum Thema Konflikte und Konsens English: Workshop...

Click to read more »
File:Conflict Engagement & Consensus Building In Organizations at WMCON 2018 26.jpg
Minggu, 2025-11-16 19:23:08

DescriptionConflict Engagement & Consensus Building In Organizations at WMCON 2018 26.jpg Deutsch: Workshop zum Thema Konflikte und Konsens English: Workshop...

Click to read more »
File:EU-Georgia.svg
Minggu, 2026-02-15 08:11:48

0, GFDL 2009-10-23T00:52:08Z NuclearVacuum 2045x1720 (2732243 Bytes) consensus version 2009-10-18T18:17:50Z NuclearVacuum 2045x1720 (2743295 Bytes) final...

Click to read more »
File:Prédiction par consensus.png
Rabu, 2020-10-28 05:36:53

DescriptionPrédiction par consensus.png Français : Prédiction par consensus. Date 30 May 2016 Source Own work Author Mewtow...

Click to read more »
File:National Consensus Commission members meeting October 4 2025 (PID-0061256).jpg
Selasa, 2026-03-10 06:19:09

DescriptionNational Consensus Commission members meeting October 4 2025 (PID-0061256).jpg বাংলা: জাতীয় ঐকমত্য কমিশনের সদস্যবৃন্দ আজ ঢাকায় জাতীয় সংসদ...

Click to read more »
File:MiR-10 consensus structure.jpg
Minggu, 2025-03-30 13:21:23

DescriptionMiR-10 consensus structure.jpg English: A consensus secondary structure for the microRNA miR-10. Date 2 October 2010, 21:37 (UTC) Source I (Paul...

Click to read more »
File:Iveco LMV operators.png
Senin, 2020-11-09 12:28:21

recognise. 2008-03-11T18:16:50Z Avala 2100x1525 (70412 Bytes) there is no consensus in Europe 2008-02-24T02:42:03Z Hoshie 2100x1525 (131807 Bytes) Added Kosovo...

Click to read more »
File:Amador-Calaveras Consensus Group (5269127029).jpg
Minggu, 2025-06-22 19:03:17

Consensus Group (5269127029).jpg Group of people posing in front of a building Date 14 September 2009, 22:54 Source Amador-Calaveras Consensus Group...

Click to read more »
File:Conflict Engagement & Consensus Building In Organizations at WMCON 2018 04.jpg
Jumat, 2024-10-11 22:09:41

DescriptionConflict Engagement & Consensus Building In Organizations at WMCON 2018 04.jpg Deutsch: Workshop zum Thema Konflikte und Konsens English: Workshop...

Click to read more »
File:Spigelia genuflexa consensus tree.jpg
Minggu, 2026-05-17 17:40:50

DescriptionSpigelia genuflexa consensus tree.jpg English: 50% majority rule consensus tree from the Bayesian analyses. Numbers are clade posterior probability...

Click to read more »
File:Logo of the National Consensus Forces.png
Sabtu, 2026-03-21 08:40:53

vice versa. Fair use //en.wikipedia.org/wiki/File:Logo_of_the_National_Consensus_Forces.png true Fair use true Though this image is subject to copyright...

Click to read more »
File:Conflict Engagement & Consensus Building In Organizations at WMCON 2018 03.jpg
Kamis, 2025-11-13 01:44:00

DescriptionConflict Engagement & Consensus Building In Organizations at WMCON 2018 03.jpg Deutsch: Workshop zum Thema Konflikte und Konsens English: Workshop...

Click to read more »
File:A genuine leader is not a searcher for consensus, but a molder of consensus. Martin Luther King, 1929-1968 - en.svg
Kamis, 2023-06-29 09:27:54

DescriptionA genuine leader is not a searcher for consensus, but a molder of consensus. Martin Luther King, 1929-1968 - en.svg Português: Um líder autêntico...

Click to read more »
File:Freedom of panorama and Wikimedia Commons.pdf
Senin, 2025-04-21 23:53:20

proposal – “no freedom of panorama” criterion removed No community wide consensus yet Problem 2: Disagreement on interpretation � Causes of disagreement:...

Click to read more »
File:Conflict Engagement & Consensus Building In Organizations at WMCON 2018 19.jpg
Jumat, 2025-09-26 06:37:43

DescriptionConflict Engagement & Consensus Building In Organizations at WMCON 2018 19.jpg Deutsch: Workshop zum Thema Konflikte und Konsens English: Workshop...

Click to read more »
File:Invertebrate Ortholog Alignment with human Transmembrane Protein 144.pdf
Kamis, 2024-12-05 12:03:39

alignment of human Transmembrane Protein 144 to invertebrate orthologs. Consensus sequences denote highly conserved amino acids with a capital letter, moderately...

Click to read more »
File:Conflict Engagement & Consensus Building In Organizations at WMCON 2018 28.jpg
Selasa, 2025-12-16 09:58:28

DescriptionConflict Engagement & Consensus Building In Organizations at WMCON 2018 28.jpg Deutsch: Workshop zum Thema Konflikte und Konsens English: Workshop...

Click to read more »
File:Conflict Engagement & Consensus Building In Organizations at WMCON 2018 29.jpg
Selasa, 2025-12-16 09:58:29

DescriptionConflict Engagement & Consensus Building In Organizations at WMCON 2018 29.jpg Deutsch: Workshop zum Thema Konflikte und Konsens English: Workshop...

Click to read more »
File:Nl-consensus.ogg
Minggu, 2024-10-13 01:57:52

DescriptionNl-consensus.ogg male voice pronunciation for "consensus" . Date 29 October 2013 Source Own work Author Marcel Coenders...

Click to read more »
File:Consensus new and old-he.svg
Jumat, 2024-04-12 08:39:32

DescriptionConsensus new and old-he.svg Based on Image:Consensus new and old.svg which was based on Image:Consensus plain.svg (User:Kim Bruning) and w:Image:Consensus...

Click to read more »
File:A genuine leader is not a searcher for consensus, but a molder of consensus. Martin Luther King, 1929-1968 -pt.svg
Kamis, 2026-02-26 12:17:22

{{subst:idw|File:A genuine leader is not a searcher for consensus, but a molder of consensus. Martin Luther King, 1929-1968 -pt.svg|Files in Category:Quotations...

Click to read more »
File:Conflict Engagement & Consensus Building In Organizations at WMCON 2018 14.jpg
Selasa, 2025-12-16 09:58:20

DescriptionConflict Engagement & Consensus Building In Organizations at WMCON 2018 14.jpg Deutsch: Workshop zum Thema Konflikte und Konsens English: Workshop...

Click to read more »
File:Conflict Engagement & Consensus Building In Organizations at WMCON 2018 25.jpg
Selasa, 2025-12-16 09:58:27

DescriptionConflict Engagement & Consensus Building In Organizations at WMCON 2018 25.jpg Deutsch: Workshop zum Thema Konflikte und Konsens English: Workshop...

Click to read more »
File:National Consensus Commission Discussions Dhaka 2025-07-27 (PID-0000716).jpg
Jumat, 2025-11-14 14:22:15

DescriptionNational Consensus Commission Discussions Dhaka 2025-07-27 (PID-0000716).jpg বাংলা: জাতীয় ঐকমত্য কমিশনের সাথে আজ ঢাকায় ফরেন সার্ভিস একাডেমিতে...

Click to read more »
File:Conflict Engagement & Consensus Building In Organizations at WMCON 2018 15.jpg
Kamis, 2024-04-11 11:46:07

DescriptionConflict Engagement & Consensus Building In Organizations at WMCON 2018 15.jpg Deutsch: Workshop zum Thema Konflikte und Konsens English: Workshop...

Click to read more »
File:Conflict Engagement & Consensus Building In Organizations at WMCON 2018 10.jpg
Selasa, 2025-12-16 09:58:17

DescriptionConflict Engagement & Consensus Building In Organizations at WMCON 2018 10.jpg Deutsch: Workshop zum Thema Konflikte und Konsens English: Workshop...

Click to read more »
File:Conflict Engagement & Consensus Building In Organizations at WMCON 2018 17.jpg
Senin, 2025-11-24 02:58:14

DescriptionConflict Engagement & Consensus Building In Organizations at WMCON 2018 17.jpg Deutsch: Workshop zum Thema Konflikte und Konsens English: Workshop...

Click to read more »
File:Commonwealth of Nations (simple).png
Senin, 2024-04-08 09:22:05

Bytes) Reverted to version as of 18:25, 11 March 2008 - international consensus should be present - Kosovo independent map should be variant 2008-03-13T16:40:34Z...

Click to read more »
File:Conflict Engagement & Consensus Building In Organizations at WMCON 2018 22.jpg
Minggu, 2024-12-29 15:52:46

DescriptionConflict Engagement & Consensus Building In Organizations at WMCON 2018 22.jpg Deutsch: Workshop zum Thema Konflikte und Konsens English: Workshop...

Click to read more »
File:Vuitton et al - International consensus on terminology - parasite200043-fig3.png
Kamis, 2025-10-16 21:06:14

DescriptionVuitton et al - International consensus on terminology - parasite200043-fig3.png English: Figure 3 of the paper “AORC” nomenclature framework...

Click to read more »
File:Consensus new and old zh-hans.svg
Jumat, 2024-04-12 08:39:39

DescriptionConsensus new and old zh-hans.svg English: Translated (Simplified Chinese) version of Image:Consensus new and old.svg 中文(简体):​Image:Consensus new...

Click to read more »
File:Vertabrate Ortholog Alignment for Transmembrane Protein 144.pdf
Sabtu, 2023-06-03 04:35:00

alignment of human Transmembrane Protein 144 to vertebrate orthologs. Consensus sequences denote highly conserved amino acids with a capital letter, moderately...

Click to read more »
File:Conflict Engagement & Consensus Building In Organizations at WMCON 2018 08.jpg
Selasa, 2025-12-16 09:58:15

DescriptionConflict Engagement & Consensus Building In Organizations at WMCON 2018 08.jpg Deutsch: Workshop zum Thema Konflikte und Konsens English: Workshop...

Click to read more »
File:Method for consensus building (Chinese) 2022-04-21 103729.png
Kamis, 2022-04-21 23:48:33

for consensus building (Chinese) 2022-04-21 103729.png 中文(中国大陆):​The diagram illustrates all of the simple processes involved in building consensus. Date...

Click to read more »
File:National Consensus Commission Discussion Dhaka 2025-07-23 (PID-0000789).jpg
Sabtu, 2026-01-17 19:47:07

DescriptionNational Consensus Commission Discussion Dhaka 2025-07-23 (PID-0000789).jpg বাংলা: জাতীয় ঐকমত্য কমিশনের সাথে আজ ঢাকায় ফরেন সার্ভিস একাডেমিতে...

Click to read more »
File:Conflict Engagement & Consensus Building In Organizations at WMCON 2018 09.jpg
Selasa, 2025-12-16 09:58:15

DescriptionConflict Engagement & Consensus Building In Organizations at WMCON 2018 09.jpg Deutsch: Workshop zum Thema Konflikte und Konsens English: Workshop...

Click to read more »
File:Romani population average estimate.png
Rabu, 2020-10-28 05:58:44

recognise. 2008-03-11T18:15:58Z Avala 1360x1245 (86403 Bytes) there is no consensus in Europe 2008-02-24T14:02:27Z Hoshie 1360x1245 (86480 Bytes) Added Kosovo...

Click to read more »
File:Evaluation of causes of large 96-h and 120-h track errors in the Western North Pacific (IA evaluationofcaus109452808).pdf
Minggu, 2024-10-20 16:31:27

selective consensus (SCON) by proper removal of a likely erroneous track forecast is hypothesized to be more accurate than the non-selective consensus (NCON)...

Click to read more »
File:Conflict Engagement & Consensus Building In Organizations at WMCON 2018 18.jpg
Selasa, 2025-12-16 09:58:22

DescriptionConflict Engagement & Consensus Building In Organizations at WMCON 2018 18.jpg Deutsch: Workshop zum Thema Konflikte und Konsens English: Workshop...

Click to read more »
File:Conflict Engagement & Consensus Building In Organizations at WMCON 2018 21.jpg
Senin, 2025-09-22 08:24:13

DescriptionConflict Engagement & Consensus Building In Organizations at WMCON 2018 21.jpg Deutsch: Workshop zum Thema Konflikte und Konsens English: Workshop...

Click to read more »
File:Vuitton et al - International consensus on terminology - parasite200043-fig2ab.png
Minggu, 2024-07-21 06:13:49

DescriptionVuitton et al - International consensus on terminology - parasite200043-fig2ab.png English: Figure 2A & 2B of the paper General description...

Click to read more »
File:ARG orthographic (+all claims).svg
Kamis, 2025-07-17 23:51:30

the Spanish Wikipedia style conventions. Please do not edit unless a consensus has been reached on the Spanish Wikipedia. If the conventions of other...

Click to read more »
File:National Consensus Commission Meeting July 21 2025 (PID-0000814).jpg
Sabtu, 2026-01-17 17:48:41

DescriptionNational Consensus Commission Meeting July 21 2025 (PID-0000814).jpg বাংলা: জাতীয় ঐকমত্য কমিশনের সাথে আজ ঢাকায় ফরেন সার্ভিস একাডেমিতে বিভিন্ন...

Click to read more »
File:Quorum im Quorum-Consensus-Verfahren.svg
Senin, 2023-08-28 10:40:11

DescriptionQuorum im Quorum-Consensus-Verfahren.svg Deutsch: Lese- und Schreibquorum im Quorum-Consensus-Verfahren. Date 27 March 2007 Source Own work...

Click to read more »
File:LL-Q150 (fra)-Poslovitch-consensus approximatif.wav
Sabtu, 2025-08-16 08:50:02

(fra)-Poslovitch-consensus approximatif.wav Audio pronunciation file from the Lingua Libre project. Language InfoField French Transcription InfoField consensus approximatif...

Click to read more »
File:Meeting National Consensus Commission Political Parties Dhaka 2025-06-02 (PID-0001532).jpg
Kamis, 2025-11-06 22:17:09

DescriptionMeeting National Consensus Commission Political Parties Dhaka 2025-06-02 (PID-0001532).jpg বাংলা: জাতীয় ঐকমত্য কমিশনের সভাপতি প্রধান উপদেষ্টা...

Click to read more »
File:Conflict Engagement & Consensus Building In Organizations at WMCON 2018 24.jpg
Selasa, 2025-12-16 09:58:26

DescriptionConflict Engagement & Consensus Building In Organizations at WMCON 2018 24.jpg Deutsch: Workshop zum Thema Konflikte und Konsens English: Workshop...

Click to read more »
File:National Consensus Commission Meeting Dhaka 2025-06-16 (PID-0001383).jpg
Kamis, 2025-11-06 22:13:04

DescriptionNational Consensus Commission Meeting Dhaka 2025-06-16 (PID-0001383).jpg বাংলা: প্রধান উপদেষ্টা এবং জাতীয় ঐকমত্য কমিশনের সভাপতি প্রফেসর মুহাম্মদ...

Click to read more »
File:National Consensus Commission Meeting July 27 2025" (PID-0000110).jpg
Sabtu, 2026-01-17 13:08:57

DescriptionNational Consensus Commission Meeting July 27 2025" (PID-0000110).jpg বাংলা: জাতীয় ঐকমত্য কমিশনের সহসভাপতি অধ্যাপক আলী রীয়াজ আজ ঢাকায় সংসদ...

Click to read more »
File:LL-Q150 (fra)-Poslovitch-Consensus geth.wav
Minggu, 2025-10-05 12:09:21

(fra)-Poslovitch-Consensus geth.wav Audio pronunciation file from the Lingua Libre project. Language InfoField French Transcription InfoField Consensus geth Date...

Click to read more »
File:Consensus 2026 - Charles Hoskinson 05 (cropped).jpg
Selasa, 2026-05-12 00:46:26

DescriptionConsensus 2026 - Charles Hoskinson 05 (cropped).jpg English: Charles Hoskinson at Consensus Hong Kong 2026 Date 12 February 2026, 00:18:16...

Click to read more »
File:Conflict Engagement & Consensus Building In Organizations at WMCON 2018 05.jpg
Selasa, 2025-12-16 09:58:13

DescriptionConflict Engagement & Consensus Building In Organizations at WMCON 2018 05.jpg Deutsch: Workshop zum Thema Konflikte und Konsens English: Workshop...

Click to read more »
File:Democracies Patterns of Majoritarian & Consensus Government in Twenty-one Countries.jpg
Jumat, 2026-01-30 09:07:46

information. Fair use //en.wikipedia.org/wiki/File:Democracies_Patterns_of_Majoritarian_%26_Consensus_Government_in_Twenty-one_Countries.jpg true Fair use true...

Click to read more »
File:Cuckoo RNA consensus structure (three stem-loops).pdf
Sabtu, 2024-04-27 23:15:12

DescriptionCuckoo RNA consensus structure (three stem-loops).pdf English: consensus structure of cuckoo RNAs that consist of three stem-loops Date 15...

Click to read more »
File:Conflict Engagement & Consensus Building In Organizations at WMCON 2018 16.jpg
Selasa, 2025-12-16 09:58:21

DescriptionConflict Engagement & Consensus Building In Organizations at WMCON 2018 16.jpg Deutsch: Workshop zum Thema Konflikte und Konsens English: Workshop...

Click to read more »
File:Conflict Engagement & Consensus Building In Organizations at WMCON 2018 01.jpg
Selasa, 2025-12-16 09:58:09

DescriptionConflict Engagement & Consensus Building In Organizations at WMCON 2018 01.jpg Deutsch: Workshop zum Thema Konflikte und Konsens English: Workshop...

Click to read more »
File:BLOCKCHAIN FOR USE IN COLLABORATIVE INTRUSION DETECTION SYSTEMS (IA blockchainforuse1094563465).pdf
Rabu, 2024-08-21 14:51:38

it is mathematically impractical to modify a block [9]. 2.3.3 Consensus Consensus algorithms allow participants in a blockchain network to reach agreement...

Click to read more »
File:Conflict Engagement & Consensus Building In Organizations at WMCON 2018 07.jpg
Selasa, 2025-12-16 09:58:14

DescriptionConflict Engagement & Consensus Building In Organizations at WMCON 2018 07.jpg Deutsch: Workshop zum Thema Konflikte und Konsens English: Workshop...

Click to read more »
File:National Consensus Commission Discussion Dhaka 2025-07-10 (PID-0001009).jpg
Minggu, 2025-11-23 14:29:22

DescriptionNational Consensus Commission Discussion Dhaka 2025-07-10 (PID-0001009).jpg বাংলা: জাতীয় ঐকমত্য কমিশনের সাথে আজ ঢাকায় ফরেন সার্ভিস একাডেমিতে...

Click to read more »
File:National Consensus Commission Discussions Dhaka 2025-07-30 (PID-0000632).jpg
Kamis, 2025-11-06 22:13:02

DescriptionNational Consensus Commission Discussions Dhaka 2025-07-30 (PID-0000632).jpg বাংলা: জাতীয় ঐকমত্য কমিশনের সাথে আজ ঢাকায় ফরেন সার্ভিস একাডেমিতে...

Click to read more »
File:Objective identification of environmental patterns related to tropical cyclone track forecast errors (IA objectiveidentif109452621).pdf
Kamis, 2025-01-02 17:26:04

Description The increase in skill of numerical model guidance and the use of consensus forecast techniques have led to significant improvements in the accuracy...

Click to read more »
File:EU mercury thermometer ban.png
Sabtu, 2025-01-04 13:17:25

recognise. 2008-03-11T18:15:58Z Avala 1360x1245 (86403 Bytes) there is no consensus in Europe 2008-02-24T14:02:27Z Hoshie 1360x1245 (86480 Bytes) Added Kosovo...

Click to read more »
File:Periodic table consensus.png
Selasa, 2026-05-19 10:33:46

DescriptionPeriodic table consensus.png English: Periodic table Date 16 May 2020 Source Own work Author Droog Andrey...

Click to read more »
File:Major consensus tree of Therocephalia relationships.jpg
Senin, 2024-09-16 02:37:32

DescriptionMajor consensus tree of Therocephalia relationships.jpg English: Numbers above the branch indicate Bremer support of the clades (only values...

Click to read more »
File:National Consensus Commission Discussions Dhaka 2025-07-21 (PID-0000815).jpg
Sabtu, 2026-01-17 17:57:59

DescriptionNational Consensus Commission Discussions Dhaka 2025-07-21 (PID-0000815).jpg বাংলা: জাতীয় ঐকমত্য কমিশনের সাথে আজ ঢাকায় ফরেন সার্ভিস একাডেমিতে...

Click to read more »
File:Cuckoo RNA consensus structure (four stem-loops).pdf
Sabtu, 2024-04-27 23:15:11

DescriptionCuckoo RNA consensus structure (four stem-loops).pdf English: consensus structure of cuckoo RNAs that consist of four stem-loops Date 15 December...

Click to read more »
File:Edgarosaurus (1).jpg
Minggu, 2026-05-31 22:38:06

There is consensus in the scientific literature, that Edgarosaurus is member of the family Polycotylidae. Where this family is positioned within the Plesiosauria...

Click to read more »
File:Commentatio, in qua doctrina Platonis ethica cum Christiana comparatur ita ut utriusque tum consensus tum discrimen exponatur (microform) (IA 4624638).pdf
Minggu, 2025-12-14 13:47:26

doctrina Platonis ethica cum Christiana comparatur ita ut utriusque tum consensus tum discrimen exponatur [microform]   (  ) Author Grotefend, Friedrich...

Click to read more »
File:TWT 2018 - New Economic Consensus (43113263470).jpg
Senin, 2025-09-15 12:57:57

New Economic Consensus (43113263470).jpg The World Transformed 2018 in Liverpool Date 23 September 2018, 13:07 Source New Economic Consensus Author Kevin...

Click to read more »
File:LL-Q150 (fra)-DenisdeShawi-consensus laurentien.wav
Minggu, 2023-04-23 22:06:21

(fra)-DenisdeShawi-consensus laurentien.wav Audio pronunciation file from the Lingua Libre project. Language InfoField French Transcription InfoField consensus laurentien...

Click to read more »
File:Introduction Howard.-EU-001.webm
Selasa, 2024-07-16 06:08:10

been that flattened hierarchies do not necessarily mean decisions go by consensus — people often take the ball and run with it. The handbook includes co-edited...

Click to read more »
File:CCDC132 Stict Ortho.pdf
Rabu, 2025-05-07 22:15:49

Equus_caballus Canis_familiari Cow Chicken_CCDC132 Human Xenopus Mouse_FLJ20097_ consensus 1 1 1 1 1 1 1 1 1 MQKIKSLMTRQG-------------------------------------...

Click to read more »
File:Consensus Neighbor-Joining Tree of Populations.png
Senin, 2025-07-07 22:20:58

DescriptionConsensus Neighbor-Joining Tree of Populations.png English: Consensus Neighbor-Joining Tree of Populations The thickest edges have at least...

Click to read more »
File:Stonetoss consensus.png
Jumat, 2024-10-04 23:06:12

DescriptionStonetoss consensus.png English: Consensus Date 10 September 2024 Source Own work Author BarakHussan...

Click to read more »
File:Kozak consensus.png
Rabu, 2022-08-24 07:03:16

DescriptionKozak consensus.png This file has no description, and may be lacking other information. Please provide a meaningful description of this file...

Click to read more »
File:Jan van Eyck - Diptych - WGA07587.jpg
Jumat, 2015-02-13 01:33:13

This image was previously a featured picture, but community consensus determined that it no longer meets our featured-picture criteria. If you have a...

Click to read more »
File:Calling for consensus demonstration in front of Beit HaNassi - Avigdor Kahalani.jpg
Sabtu, 2023-11-18 18:41:36

DescriptionCalling for consensus demonstration in front of Beit HaNassi - Avigdor Kahalani.jpg English: Avigdor Kahalani in calling for consensus demonstration...

Click to read more »
File:Meeting Of National Consensus Commission Dhaka 2025-07-17 (PID-0000877).jpg
Senin, 2026-05-25 04:12:08

DescriptionMeeting Of National Consensus Commission Dhaka 2025-07-17 (PID-0000877).jpg বাংলা: প্রধান উপদেষ্টা প্রফেসর মুহাম্মদ ইউনূস আজ ঢাকায় রাষ্ট্রীয়...

Click to read more »
File:IMES-2-consensus.svg
Sabtu, 2023-06-03 19:26:18

DescriptionIMES-2-consensus.svg English: Adapted from figures I created for this paper: (March 2010). "Comparative genomics reveals 104 candidate structured...

Click to read more »
File:Oppose card.png
Kamis, 2020-09-17 12:09:29

wikibooks. 2007-04-30 03:37 Xixtas 15×15× (839 bytes) Own work. 2007-04-27 23:54 Xixtas 15×15× (839 bytes) Own work. Card icon for consensus polling. English...

Click to read more »
File:Consensus 2018 Protest against Bitcoin (28582802068).jpg
Selasa, 2024-07-09 01:14:36

DescriptionConsensus 2018 Protest against Bitcoin (28582802068).jpg Consensus 2018 Protest against Bitcoin Date 15 May 2018, 17:52 Source Consensus 2018 Protest...

Click to read more »
File:2020 collage per consensus feb5.23.png
Sabtu, 2026-01-03 01:49:10

Description2020 collage per consensus feb5.23.png English: 2020 Events Collage per Consensus English: Clockwise from top-left: Ukraine International Airlines...

Click to read more »
File:LL-Q150 (fra)-Poslovitch-consensus permissif.wav
Minggu, 2023-04-23 22:05:18

(fra)-Poslovitch-consensus permissif.wav Audio pronunciation file from the Lingua Libre project. Language InfoField French Transcription InfoField consensus permissif...

Click to read more »
File:Boston area neighborhood consensus - DPLA - 86f95faaee5b0d1c2e523be59061a6b5.jpg
Selasa, 2026-02-10 14:08:29

neighborhood consensus   (  ) Creator InfoField Woodruff, Andy; Wallace, Timothy R. (Timothy Robert) Title Boston area neighborhood consensus Description...

Click to read more »
File:National Consensus Commission meeting in Dhaka 2025-09-14 (PID-0060896).jpg
Kamis, 2025-11-06 22:17:07

DescriptionNational Consensus Commission meeting in Dhaka 2025-09-14 (PID-0060896).jpg বাংলা: প্রধান উপদেষ্টা প্রফেসর মুহাম্মদ ইউনূস আজ ঢাকায় ফরেন সার্ভিস...

Click to read more »
File:Scientific consensus - Earth's climate is warming (Temperature Anomaly ℃).png
Rabu, 2025-10-08 03:11:31

DescriptionScientific consensus - Earth's climate is warming (Temperature Anomaly ℃).png English: Temperature data (in degrees Celsius) from four international...

Click to read more »
File:Meeting of National Consensus Commission Dhaka 2025-10-15 (PID-0061471).jpg
Minggu, 2026-02-01 13:23:03

DescriptionMeeting of National Consensus Commission Dhaka 2025-10-15 (PID-0061471).jpg বাংলা: প্রধান উপদেষ্টা প্রফেসর মুহাম্মদ ইউনূস আজ ঢাকায় ফরেন সার্ভিস...

Click to read more »
File:Calling for consensus demonstration in front of Beit HaNassi 02.jpg
Sabtu, 2023-11-18 18:41:45

DescriptionCalling for consensus demonstration in front of Beit HaNassi 02.jpg English: calling for consensus demonstration in front of Beit HaNassi. Strengthen...

Click to read more »
File:Understanding the organizational decision process at the theater Commander-in-Chief level of command (IA understandingorg1094534863).pdf
Minggu, 2024-08-18 00:31:03

most prevalent. The decision-making group places an emphasis upon goal consensus, and their state of technical knowledge is dependent upon the stability...

Click to read more »
File:General Assembly GA 11437.pdf
Jumat, 2025-07-11 20:57:59

representative of the Netherlands was among some who disassociated themselves from consensus. He said that, although he supported the principle of the inalienable...

Click to read more »
File:Vuitton et al - International consensus on terminology - parasite200043-fig2c.png
Senin, 2025-11-17 10:38:24

DescriptionVuitton et al - International consensus on terminology - parasite200043-fig2c.png English: Figure 2C of the paper General description of the...

Click to read more »
File:BLOCKCHAIN TECHNOLOGY IN THE DEPARTMENT OF DEFENSE (IA blockchaintechno1094561355).pdf
Minggu, 2024-08-18 12:58:35

consensus protocols create a secure, efficient, and convenient method for transacting with others (Zheng et al., 2017). Importantly, these consensus protocols...

Click to read more »
File:Dhaka National Consensus Commission Discussions 2025-06-25 (PID-0001229).jpg
Minggu, 2026-04-26 12:20:06

DescriptionDhaka National Consensus Commission Discussions 2025-06-25 (PID-0001229).jpg বাংলা: জাতীয় ঐকমত্য কমিশনের সাথে আজ ঢাকায় ফরেন সার্ভিস একাডেমিতে...

Click to read more »
File:MEX orthographic.svg
Kamis, 2025-07-17 11:51:20

the Spanish Wikipedia style conventions. Please do not edit unless a consensus has been reached on the Spanish Wikipedia. If the conventions of other...

Click to read more »
File:National Consensus Commission Discussions With United People's Democratic Front 2025-05-10 (PID-0001989).jpg
Jumat, 2026-03-20 16:14:36

DescriptionNational Consensus Commission Discussions With United People's Democratic Front 2025-05-10 (PID-0001989).jpg বাংলা: জাতীয় ঐকমত্য কমিশনের সাথে...

Click to read more »
File:Theoretical model of wikipedia consensus.PNG
Senin, 2020-09-28 08:01:31

DescriptionTheoretical model of wikipedia consensus.PNG English: Theoretical model of wikipedia consensus. Trying to explain why, although consensus can change, it generally...

Click to read more »
File:Calling for consensus demonstration in front of Beit HaNassi - Reb Menachem Bombach.jpg
Sabtu, 2023-11-18 18:41:39

DescriptionCalling for consensus demonstration in front of Beit HaNassi - Reb Menachem Bombach.jpg English: Reb Menachem Bombach in calling for consensus demonstration...

Click to read more »
File:National Consensus Commission Meeting Dhaka 2025-02-15 (PID-0003504).jpg
Kamis, 2025-11-06 22:11:10

DescriptionNational Consensus Commission Meeting Dhaka 2025-02-15 (PID-0003504).jpg বাংলা: ঢাকায় ফরেন সার্ভিস একাডেমিতে প্রধান উপদেষ্টা প্রফেসর মুহাম্মদ...

Click to read more »
File:UK USA consensus.png
Senin, 2024-01-08 07:56:47

DescriptionUK USA consensus.png English: Labeling sources showing a lack of global consensus. Date 7 January 2024 Source Own work Author Irtapil...

Click to read more »
File:Meeting of July Warriors and National Consensus Commission, Dhaka, 2025-10-20 (PID-0060756).jpg
Jumat, 2026-01-16 08:46:53

DescriptionMeeting of July Warriors and National Consensus Commission, Dhaka, 2025-10-20 (PID-0060756).jpg বাংলা: জাতীয় ঐকমত্য কমিশনের সাথে আজ ঢাকায়...

Click to read more »
File:Cuckoo RNA consensus structure (two stem-loops).pdf
Sabtu, 2024-04-27 23:15:13

DescriptionCuckoo RNA consensus structure (two stem-loops).pdf English: consensus structure of cuckoo RNAs that consist of two stem-loops Date 15 December...

Click to read more »
File:National Consensus Commission Meeting Dhaka 2025-02-15 (PID-0003503).jpg
Jumat, 2026-03-06 20:23:30

DescriptionNational Consensus Commission Meeting Dhaka 2025-02-15 (PID-0003503).jpg বাংলা: ঢাকায় ফরেন সার্ভিস একাডেমিতে প্রধান উপদেষ্টা প্রফেসর মুহাম্মদ...

Click to read more »
File:Consensus secondary structure models of 5S rRNAs.tiff
Jumat, 2024-04-12 08:39:46

DescriptionConsensus secondary structure models of 5S rRNAs.tiff English: Secondary structure schemes made based on the covariance models used to search...

Click to read more »
File:National Consensus Commission Meeting Dhaka 2025-08-03 (PID-0000563).jpg
Minggu, 2026-02-08 05:36:19

DescriptionNational Consensus Commission Meeting Dhaka 2025-08-03 (PID-0000563).jpg বাংলা: জাতীয় ঐকমত্য কমিশনের সহসভাপতি অধ্যাপক আলী রীয়াজের সভাপতিত্বে...

Click to read more »
File:Commonwealth of Nations prospective members (simple).png
Senin, 2024-04-08 09:22:10

Bytes) Reverted to version as of 18:25, 11 March 2008 - international consensus should be present - Kosovo independent map should be variant 2008-03-13T16:40:34Z...

Click to read more »
File:Meeting National Consensus Commission Dhaka 2025-05-08 (PID-0001993).jpg
Sabtu, 2026-05-23 15:04:27

DescriptionMeeting National Consensus Commission Dhaka 2025-05-08 (PID-0001993).jpg বাংলা: প্রধান উপদেষ্টা প্রফেসর মুহাম্মদ ইউনূস আজ ঢাকায় রাষ্ট্রীয়...

Click to read more »
File:CONTINUITY AND TRANSFORMATION IN THE UNITED STATES' NUCLEAR POSTURE (IA continuityandtra1094564029).pdf
Minggu, 2024-08-18 23:26:53

Nolan, An Elusive Consensus, 51. 32 Nolan, An Elusive Consensus, 55. 33 Nolan, An Elusive Consensus, 54–55. 34 Nolan, An Elusive Consensus, 51. 35 Nolan,...

Click to read more »
File:Wiki-Tech-Culture.pdf
Jumat, 2020-12-11 18:28:00

wysiwyg / adventure of ideas Community Culture - openness & agf / npov / consensus / deletionism vs. inclusionism / controversy Date July 2008 Source User:Mountain...

Click to read more »
File:Causes of improvement in the security environment of Iraq, 2006-2009 (IA causesofimprovem109454326).pdf
Minggu, 2024-08-18 01:56:10

Publisher Monterey, California. Naval Postgraduate School Description Popular consensus exists that the 2007 surge of U.S. forces in Iraq led to an improved security...

Click to read more »
File:National Consensus Commission Meeting Dhaka 2025-02-15 (PID-0003497).jpg
Jumat, 2026-03-06 20:22:48

DescriptionNational Consensus Commission Meeting Dhaka 2025-02-15 (PID-0003497).jpg বাংলা: ঢাকায় ফরেন সার্ভিস একাডেমিতে প্রধান উপদেষ্টা প্রফেসর মুহাম্মদ...

Click to read more »
File:Relating tropical cyclone track forecast error distributions with measurements of forecast uncertainty (IA relatingtropical1094548503).pdf
Jumat, 2025-12-12 16:10:21

Medium-Range Weather Forecasts (ECMWF) ensemble spread or TVCN Goerss Predicted Consensus Error (GPCE). The statistical tests indicate that distinct error distributions...

Click to read more »
File:Consensus secondary structure of the Influenza Pseudoknot family of RNA motifs.png
Jumat, 2024-04-12 08:39:47

DescriptionConsensus secondary structure of the Influenza Pseudoknot family of RNA motifs.png English: The consensus secondary structure of the Influenza...

Click to read more »
File:Group consensus building session 2017-08-10 1.jpg
Senin, 2026-02-09 02:38:23

DescriptionGroup consensus building session 2017-08-10 1.jpg English: Group consensus building session at Wikimania 2017 Learning Days Date 10 August 2017...

Click to read more »
File:Characteristic errors in 120-H tropical cyclone track forecasts in the western North Pacific (IA characteristicer109452208).pdf
Minggu, 2024-08-18 13:55:31

an error mechanism could form a selective consensus that will be more accurate than a non-selective consensus. Subjects: Cyclone forecasting; North Pacific...

Click to read more »
File:High-frequency meteorological phenomena observed with the Naval Postgraduate School's UHF Doppler Wind Profiler (IA highfrequencymet1094527682).pdf
Rabu, 2025-04-09 04:39:15

published work to-date has concentrated on interpretation of hourly-consensus data. But with the onset of improved technology, it is now possible to...

Click to read more »
File:National Consensus Commission Dialogue With Khelafat Majlis 2025-03-22 (PID-0002851).jpg
Sabtu, 2026-03-07 07:08:39

DescriptionNational Consensus Commission Dialogue With Khelafat Majlis 2025-03-22 (PID-0002851).jpg বাংলা: রাজনৈতিক দলগুলোর সাথে সংলাপের দ্বিতীয় দিনে...

Click to read more »
File:A dictionary of acquisition and contracting terms (IA adictionaryofcqu1094539814).pdf
Selasa, 2024-08-20 14:29:46

Association professionals in previous research efforts which lacked significant consensus and refines them using a Delphi Technique. This research is a joint effort...

Click to read more »
File:2025-08-28 Ali Riaz National Consensus Commission Meeting Dhaka (PID-0000096).jpg
Minggu, 2026-01-25 08:29:44

Description2025-08-28 Ali Riaz National Consensus Commission Meeting Dhaka (PID-0000096).jpg বাংলা: জাতীয় ঐকমত্য কমিশনের সহসভাপতি অধ্যাপক আলী রীয়াজ...

Click to read more »
File:Political Parties Discussion National Consensus Commission Dhaka 2025-07-20 (PID-0000839).jpg
Jumat, 2026-01-16 08:36:21

DescriptionPolitical Parties Discussion National Consensus Commission Dhaka 2025-07-20 (PID-0000839).jpg বাংলা: জাতীয় ঐকমত্য কমিশনের সাথে আজ ঢাকায় ফরেন...

Click to read more »
File:Group Consensus Building at Learning Days Wikimania 2017.jpg
Senin, 2026-02-09 02:38:24

DescriptionGroup Consensus Building at Learning Days Wikimania 2017.jpg English: Group Consensus Building at Learning Days Wikimania 2017 Date 10 August...

Click to read more »
File:NIH 1991 Consensus Panel Acoustic Neuroma - cover.jpg
Jumat, 2026-01-02 12:08:01

DescriptionNIH 1991 Consensus Panel Acoustic Neuroma - cover.jpg English: NIH 1991 Consensus Panel Acoustic Neuroma - cover Date 30 September 2016, 12:42:20...

Click to read more »
File:Multiple sequence alignment of human Transmembrane Protein 144 to vertebrate orthologs.pdf
Jumat, 2023-08-04 14:16:57

KKFDTGDGMFFQWAMCTSIWLVGLVSNFIQH consensus/100% ...s.tphhhGa.sshhs.hhato.FsPhK+h-TGDGhFhQWhhssuIW.luLlsshl.p consensus/80% .tpsssshshGahusslAslhaGoNFV...

Click to read more »
File:Auditory cortical representation of music favours the perceived beat.pdf
Senin, 2025-04-21 08:16:31

feature of the consensus beat, but could they also capture how closely listeners agree on a consensus beat? The strength of the tapping consensus was quantified...

Click to read more »
File:Trying to achieve International Consensus on Aid Effectiveness.ogg
Rabu, 2025-08-06 13:44:45

DescriptionTrying to achieve International Consensus on Aid Effectiveness.ogg English: Critiques of the impact of aid argue that aid is only one of the...

Click to read more »
File:Knowledge of German EU map (2010).svg
Senin, 2026-03-30 22:35:32

fixing glitch 2009-10-23T14:55:55Z NuclearVacuum 2045x1720 (2732292 Bytes) consensus version 2009-10-20T17:19:31Z NuclearVacuum 2045x1720 (2732278 Bytes) green...

Click to read more »
File:National Consensus Commission meeting Dhaka 2025-09-11 (PID-0060867).jpg
Kamis, 2025-11-06 22:13:08

DescriptionNational Consensus Commission meeting Dhaka 2025-09-11 (PID-0060867).jpg বাংলা: প্রধান উপদেষ্টা প্রফেসর মুহাম্মদ ইউনূসের নেতৃত্বে আজ ঢাকায়...

Click to read more »
File:Dhaka Doel Hall National Consensus Commission Discussions 2025-06-18 (PID-0001355).jpg
Minggu, 2025-11-09 08:22:51

DescriptionDhaka Doel Hall National Consensus Commission Discussions 2025-06-18 (PID-0001355).jpg বাংলা: জাতীয় ঐকমত্য কমিশনের সাথে আজ ঢাকায় ফরেন সার্ভিস...

Click to read more »
File:Bangladesh Khelafat Majlish Discussion With National Consensus Commission 2025-04-21 (PID-0002308).jpg
Sabtu, 2026-01-24 07:40:17

DescriptionBangladesh Khelafat Majlish Discussion With National Consensus Commission 2025-04-21 (PID-0002308).jpg বাংলা: জাতীয় ঐকমত্য কমিশনের সাথে আজ...

Click to read more »
File:Final MRRIC annual report, 2008-2009, Missouri River Recovery Implementation Committee - USACE-p16021coll7-7276.pdf
Rabu, 2025-04-09 00:16:36

RECOMMENDATIONS 6 Substantive Consensus Recommendations to the USACE..................................... 6 Tentative Substantive Consensus Recommendation to the...

Click to read more »
File:Cpb And National Consensus Commission Meeting Dhaka 2025-05-13 (PID-0001926).jpg
Senin, 2026-01-26 18:31:14

DescriptionCpb And National Consensus Commission Meeting Dhaka 2025-05-13 (PID-0001926).jpg বাংলা: জাতীয় ঐকমত্য কমিশনের সাথে আজ ঢাকায় জাতীয় সংসদ ভবনের...

Click to read more »
File:United Nations reform- the need for legitimacy (IA unitednationsref1094542826).pdf
Selasa, 2020-09-08 10:25:53

United Nations is unique in its potential ability to build international consensus and to bring international legitimacy to collective response efforts....

Click to read more »
File:UNHRC consensus on Hong Kong national security law.svg
Sabtu, 2025-12-27 00:39:24

DescriptionUNHRC consensus on Hong Kong national security law.svg English: Coloured consensus of countries explicitly opposed or supportive of the 2020...

Click to read more »
File:OLC,Overlap-Layout-consensus.png
Jumat, 2020-10-16 01:56:50

DescriptionOLC,Overlap-Layout-consensus.png 中文(繁體):​序列組裝方法 Date 8 June 2017 Source Own work Author Dr.who what what...

Click to read more »
File:Annual report to the Office of Management and Budget on the implementation of OBM Circular A-119 and P.L. 104-113, covering the period- October 1, 1998 through September 30, 1999 (IA annualreporttoof6494unse).pdf
Sabtu, 2024-08-17 06:06:44

(NTTAA) 1 2.2 OMB Circular A-1 19 and 2.2.1 Agencies use of voluntary consensus standards versus government-unique standards 2.2.2 Guidance 2.2.3 ...

Click to read more »
File:Who's Behind Wikipedia? slides Brianna Laugher.pdf
Jumat, 2020-12-11 04:41:57

future ● Anyone can edit (Assume Good Faith) ●Free content: copyleft ●Consensus decisions ●NPOV ●No ownership ●Incremental progress ● navigation ● What...

Click to read more »
File:Toward equitable open research - stakeholder co-created recommendations for research institutions, funders and researchers.pdf
Jumat, 2025-12-26 08:31:12

already at consensus, 4 were nearly at consensus, 6 were further from consensus and 2 6 During Phases 1 and 2, we did not apply consensus rules. Rather...

Click to read more »
File:1997 annual report on the implementation of Office of Management and Budget (OMB) circular A-119 and P.L. 104-113 (IA 1997annualreport6412cook).pdf
Selasa, 2024-08-20 04:36:18

Use of Voluntary Consensus Standards,” there has been longstanding presumption in favor of Federal agencies using voluntary consensus standards, rather...

Click to read more »